Vitronectin/S-protein Polyclonal antibody

• 

  WB analysis of human plasma using 15833-1-AP

  human serum was subjected to SDS PAGE followed by western blot with 15833-1-AP (Vitronectin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15833-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15833-1-AP (Vitronectin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15833-1-AP

  rat plasma was subjected to SDS PAGE followed by western blot with 15833-1-AP (Vitronectin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 15833-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 15833-1-AP (Vitronectin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 15833-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15833-1-AP (Vitronectin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 15833-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15833-1-AP (Vitronectin antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 15833-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15833-1-AP (Vitronectin antibody at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human hepatocirrhosis using 15833-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 15833-1-AP (Vitronectin antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 15833-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 15833-1-AP (Vitronectin antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 15833-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 15833-1-AP (Vitronectin antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 15833-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 15833-1-AP (Vitronectin antibody at dilution of 1:200 (under 40x lens).

• 

  IF Staining of NIH/3T3 using 15833-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed NIH/3T3 cells using 15833-1-AP (Vitronectin antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Vitronectin/S-protein Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15833-1-AP

Publications(23)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Serum-spreading factor, Somatomedin-B, S-protein, V75, Vitronectin

---

Tested Applications

• Positive WB detected in: rat plasma, human plasma, human testis tissue, NIH/3T3 cells
• Positive IHC detected in: human liver tissue, human hepatocirrhosis tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 16 publications below
• IHC: See 5 publications below
• IF: See 7 publications below

Product Information

15833-1-AP targets Vitronectin/S-protein in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, plasmodium falciparum
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8443

  Product name: Recombinant human VTN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-478 aa of BC005046

  Sequence: EVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

• Full Name: vitronectin
• Calculated Molecular Weight: 478 aa, 54 kDa
• Observed Molecular Weight: 70-75 kDa, 65 kDa,
• GenBank Accession Number: BC005046
• Gene Symbol: VTN
• Gene ID (NCBI): 7448
• RRID: AB_2216309
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04004
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vitronectin is a 75-kDa glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Stem Cell; Region-specific cellular and molecular basis of liver regeneration after acute pericentral injury; Authors - Shuyong Wang
rat	WB,IF	Brain Pathol; Reconstituting neurovascular unit with primary neural stem cells and brain microvascular endothelial cells in three-dimensional matrix.; Authors - Hongjin Wang
human	WB,IF	Sci Rep; Molecular Camouflage of Plasmodium falciparum Merozoites by Binding of Host Vitronectin to P47 Fragment of SERA5.; Authors - Takahiro Tougan
human	WB,IF	J Cell Mol Med; Induction of migration of periodontal ligament cells by selective regulation of integrin subunits.; Authors - Mari Kawamura
human		Langmuir; Characterization of Initial Cell Adhesion on Charged Polymer Substrates in Serum-Containing and Serum-Free Media.; Authors - Takashi Hoshiba
human	WB	Proteomics; SILAC-based Quantitative Proteomic Analysis of Secretome between Activated and Reverted Hepatic Stellate Cells.; Authors - Hongyu Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Jingwen (Verified Customer) (01-28-2020)

It worked well when I performed the western blot in cancer samples.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Cancer tissue