Vitronectin/S-protein Polyclonal antibody

Vitronectin/S-protein Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 15833-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Serum-spreading factor, Somatomedin-B, S-protein, V75, Vitronectin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat plasma, human plasma, human testis tissue, NIH/3T3 cells
Positive IHC detected inhuman liver tissue, human hepatocirrhosis tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15833-1-AP targets Vitronectin/S-protein in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, plasmodium falciparum
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8443

Product name: Recombinant human VTN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 126-478 aa of BC005046

Sequence: EVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Predict reactive species
Full Name vitronectin
Calculated Molecular Weight 478 aa, 54 kDa
Observed Molecular Weight 70-75 kDa, 65 kDa,
GenBank Accession NumberBC005046
Gene Symbol VTN
Gene ID (NCBI) 7448
RRIDAB_2216309
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04004
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vitronectin is a 75-kDa glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588).

Protocols

Product Specific Protocols
IF protocol for Vitronectin/S-protein antibody 15833-1-APDownload protocol
IHC protocol for Vitronectin/S-protein antibody 15833-1-APDownload protocol
WB protocol for Vitronectin/S-protein antibody 15833-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Cell Stem Cell

Region-specific cellular and molecular basis of liver regeneration after acute pericentral injury

Authors - Shuyong Wang
ratWB,IF

Brain Pathol

Reconstituting neurovascular unit with primary neural stem cells and brain microvascular endothelial cells in three-dimensional matrix.

Authors - Hongjin Wang
humanWB,IF

Sci Rep

Molecular Camouflage of Plasmodium falciparum Merozoites by Binding of Host Vitronectin to P47 Fragment of SERA5.

Authors - Takahiro Tougan
humanWB,IF

J Cell Mol Med

Induction of migration of periodontal ligament cells by selective regulation of integrin subunits.

Authors - Mari Kawamura
human

Langmuir

Characterization of Initial Cell Adhesion on Charged Polymer Substrates in Serum-Containing and Serum-Free Media.

Authors - Takashi Hoshiba
humanWB

Proteomics

SILAC-based Quantitative Proteomic Analysis of Secretome between Activated and Reverted Hepatic Stellate Cells.

Authors - Hongyu Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jingwen (Verified Customer) (01-28-2020)

It worked well when I performed the western blot in cancer samples.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Cancer tissue
Loading...
||
New chat Able
正在加载,请稍候...