Product Information
29793-1-PBS targets WNT5A/B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31507 Product name: Recombinant human WNT5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 330-380 aa of BC064694 Sequence: EGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK Predict reactive species |
| Full Name | wingless-type MMTV integration site family, member 5A |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC064694 |
| Gene Symbol | WNT5A |
| Gene ID (NCBI) | 7474 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P41221 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. There are 19 Wnt genes in the human genome that encode functionally distinct Wnt proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt members bind to the Frizzled family of seven-pass transmembrane proteins and activate several signaling pathway. Wnt5A is a member of the Wnt family of proteins, which are 38-45 kDa secreted cysteine-rich proteins with hydrophobic signal peptides.





