WNT5A/B Polyclonal antibody, PBS Only

• 

  WB analysis using 29793-1-AP (same clone as 29793-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29793-1-AP (WNT5A/B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29793-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29793-1-AP (same clone as 29793-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29793-1-AP (WNT5A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29793-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29793-1-AP (same clone as 29793-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using WNT5A antibody (29793-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29793-1-PBS in a different storage buffer formulation.

WNT5A/B Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 29793-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

WNT5A, hWNT5A, Protein Wnt 5a, Protein Wnt-5a, WNT5A B

---

Product Information

29793-1-PBS targets WNT5A/B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31507

  Product name: Recombinant human WNT5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-380 aa of BC064694

  Sequence: EGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK

• Full Name: wingless-type MMTV integration site family, member 5A
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC064694
• Gene Symbol: WNT5A
• Gene ID (NCBI): 7474
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41221
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. There are 19 Wnt genes in the human genome that encode functionally distinct Wnt proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt members bind to the Frizzled family of seven-pass transmembrane proteins and activate several signaling pathway. Wnt5A is a member of the Wnt family of proteins, which are 38-45 kDa secreted cysteine-rich proteins with hydrophobic signal peptides.