Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66546-1-Ig targets XRCC5/Ku80 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9512 Product name: Recombinant human XRCC5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 384-732 aa of BC019027 Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI Predict reactive species |
| Full Name | X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) |
| Calculated Molecular Weight | 732 aa, 83 kDa |
| Observed Molecular Weight | 80-83 kDa |
| GenBank Accession Number | BC019027 |
| Gene Symbol | XRCC5 |
| Gene ID (NCBI) | 7520 |
| RRID | AB_2881908 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P13010 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
There are at least two pathways for eukaryotes to repair DNA double-strand breaks: homologous recombination and nonhomologous end joining(NHEJ). The core NHEJ machinery includes XRCC4, DNA ligase IV and the DNA-dependent protein kinase complex, which consists of the DNA end-binding XRCC5/XRCC6 heterodimer and the catalytic subunit PRKDC. The heterdimer of XRCC5/XRCC6 enhanced teh affinity of the catalytic subunit PRKDC to DNA by 100-fold. Once the XRCC5/6 dimer association with NAA15, it can bind to the osteocalcin promoter and activate osteocalcin expression. The XRCC5/6 dimer acts as a negative regulator of transcription when together with APEX1. Some publised papers indicated that the MW of XRCC5 is 86kDa, while more papers suggested that XRCC5 is a 80kDa protein, as it was firstly introducted in publication. Thus, Ku80 and Ku86 are the same protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for XRCC5/Ku80 antibody 66546-1-Ig | Download protocol |
| IHC protocol for XRCC5/Ku80 antibody 66546-1-Ig | Download protocol |
| IP protocol for XRCC5/Ku80 antibody 66546-1-Ig | Download protocol |
| WB protocol for XRCC5/Ku80 antibody 66546-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Ku70 antibody (Cat# 66546-1-Ig) has 10 citations published in journals including Cancer Letters, Molecular Medicine, Clinical and Translational Medicine, iScience, Cell Biology International, Investigational New Drugs, DNA Repair, Histochemistry and Cell Biology, and FEBS Open Biology. Research fields span DNA double-strand break repair, cancer biology (pancreatic, breast, lung, colorectal), radiosensitization, and neurobiology (hippocampal memory, astrocyte injury), with applications in WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
Cancer Lett ITGA2 overexpression inhibits DNA repair and confers sensitivity to radiotherapies in pancreatic cancer | ||
Clin Transl Med PCDHGB7 inhibits the progression of triple-negative breast cancer by suppressing XRCC5/MYC-mediated ribosome biogenesis. | ||
iScience Single nucleotide polymorphisms rs148582811 regulates its host gene ARVCF expression to affect nicotine-associated hippocampus-dependent memory | ||
Cell Biol Int Comparison of DNA stability and its related genes of neurons derived from induced pluripotent stem cells and primary retinal neurons. |
