XRCC5/Ku80 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• XRCC5/Ku80 Monoclonal antibody (66546-1-Ig)

XRCC5/Ku80 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 66546-1-Ig

Clone No.2G5E7

Publications(10)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

KU80, XRCC5, 2G5E7, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit

• 

  WB analysis using 66546-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66546-1-Ig (XRCC5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 66546-1-Ig

  IP result of anti-XRCC5/Ku80 (IP:66546-1-Ig, 5ug; Detection:66546-1-Ig 1:20000) with HeLa cells lysate 3200 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 66546-1-Ig

  IP result of anti-XRCC5/Ku80 (IP:66546-1-Ig, 5ug; Detection:66546-1-Ig 1:40000) with HeLa cells lysate 640 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66546-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66546-1-Ig (XRCC5 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66546-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66546-1-Ig (XRCC5 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66546-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66546-1-Ig (XRCC5 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66546-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66546-1-Ig (XRCC5 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66546-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using XRCC5 antibody (66546-1-Ig, Clone: 2G5E7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66546-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 66546-1-Ig (XRCC5 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66546-1-Ig targets XRCC5/Ku80 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9512

  Product name: Recombinant human XRCC5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 384-732 aa of BC019027

  Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI

• Full Name: X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
• Calculated Molecular Weight: 732 aa, 83 kDa
• Observed Molecular Weight: 80-83 kDa
• GenBank Accession Number: BC019027
• Gene Symbol: XRCC5
• Gene ID (NCBI): 7520
• RRID: AB_2881908
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P13010
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

There are at least two pathways for eukaryotes to repair DNA double-strand breaks: homologous recombination and nonhomologous end joining(NHEJ). The core NHEJ machinery includes XRCC4, DNA ligase IV and the DNA-dependent protein kinase complex, which consists of the DNA end-binding XRCC5/XRCC6 heterodimer and the catalytic subunit PRKDC. The heterdimer of XRCC5/XRCC6 enhanced teh affinity of the catalytic subunit PRKDC to DNA by 100-fold. Once the XRCC5/6 dimer association with NAA15, it can bind to the osteocalcin promoter and activate osteocalcin expression. The XRCC5/6 dimer acts as a negative regulator of transcription when together with APEX1. Some publised papers indicated that the MW of XRCC5 is 86kDa, while more papers suggested that XRCC5 is a 80kDa protein, as it was firstly introducted in publication. Thus, Ku80 and Ku86 are the same protein.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; ITGA2 overexpression inhibits DNA repair and confers sensitivity to radiotherapies in pancreatic cancer; Authors - Chen Zhou
human	IF	Mol Med; Nuclear VPS35 attenuates NHEJ repair by sequestering Ku protein; Authors - Luping Zhang
human	IF	iScience; WASH interacts with Ku to regulate DNA double-stranded break repair.; Authors - Tao Wang
human	WB	DNA Repair (Amst); FAM21 interacts with Ku to promote the localization of WASH to DNA double strand break sites; Authors - Tao Wang
human	IF	Invest New Drugs; Radiosensitization effect of quinoline-indole-schiff base derivative 10E on non-small cell lung cancer cells in vitro and in tumor xenografts; Authors - Hongwei Liu
human	WB	FEBS Open Bio; Establishment and biological characterization of radioresistant colorectal cancer cell lines; Authors - Tian-Yin Qu