XRCC5/Ku80 Monoclonal antibody

XRCC5/Ku80 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 66546-1-Ig
Clone No.2G5E7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

KU80, XRCC5, 2G5E7, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66546-1-Ig targets XRCC5/Ku80 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9512

Product name: Recombinant human XRCC5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 384-732 aa of BC019027

Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI

Predict reactive species
Full Name X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Calculated Molecular Weight 732 aa, 83 kDa
Observed Molecular Weight 80-83 kDa
GenBank Accession NumberBC019027
Gene Symbol XRCC5
Gene ID (NCBI) 7520
RRIDAB_2881908
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP13010
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

There are at least two pathways for eukaryotes to repair DNA double-strand breaks: homologous recombination and nonhomologous end joining(NHEJ). The core NHEJ machinery includes XRCC4, DNA ligase IV and the DNA-dependent protein kinase complex, which consists of the DNA end-binding XRCC5/XRCC6 heterodimer and the catalytic subunit PRKDC. The heterdimer of XRCC5/XRCC6 enhanced teh affinity of the catalytic subunit PRKDC to DNA by 100-fold. Once the XRCC5/6 dimer association with NAA15, it can bind to the osteocalcin promoter and activate osteocalcin expression. The XRCC5/6 dimer acts as a negative regulator of transcription when together with APEX1. Some publised papers indicated that the MW of XRCC5 is 86kDa, while more papers suggested that XRCC5 is a 80kDa protein, as it was firstly introducted in publication. Thus, Ku80 and Ku86 are the same protein.

Protocols

Product Specific Protocols
WB protocol for XRCC5/Ku80 antibody 66546-1-IgDownload protocol
IHC protocol for XRCC5/Ku80 antibody 66546-1-IgDownload protocol
IF protocol for XRCC5/Ku80 antibody 66546-1-IgDownload protocol
IP protocol for XRCC5/Ku80 antibody 66546-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Lett

ITGA2 overexpression inhibits DNA repair and confers sensitivity to radiotherapies in pancreatic cancer

Authors - Chen Zhou
humanIF

Mol Med

Nuclear VPS35 attenuates NHEJ repair by sequestering Ku protein

Authors - Luping Zhang
humanIF

iScience

WASH interacts with Ku to regulate DNA double-stranded break repair.

Authors - Tao Wang
humanWB

DNA Repair (Amst)

FAM21 interacts with Ku to promote the localization of WASH to DNA double strand break sites

Authors - Tao Wang
humanIF

Invest New Drugs

Radiosensitization effect of quinoline-indole-schiff base derivative 10E on non-small cell lung cancer cells in vitro and in tumor xenografts

Authors - Hongwei Liu
humanWB

FEBS Open Bio

Establishment and biological characterization of radioresistant colorectal cancer cell lines

Authors - Tian-Yin Qu
Loading...
||
New chat Able
正在加载,请稍候...