CoraLite®555-conjugated XRCC5 Monoclonal antibody

• 

  IF Staining of HeLa using CL555-66546

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®555 XRCC5 antibody (CL555-66546, Clone: 2G5E7 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL555-66546

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®555 Anti-Human XRCC5 (CL555-66546, Clone:2G5E7) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

XRCC5 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL555-66546

Clone No.2G5E7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

KU80, CTCBF, CTC85, CTC box-binding factor 85 kDa subunit, ATP-dependent DNA helicase II 80 kDa subunit

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-66546 targets XRCC5 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9512

  Product name: Recombinant human XRCC5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 384-732 aa of BC019027

  Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI

• Full Name: X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
• Calculated Molecular Weight: 732 aa, 83 kDa
• Observed Molecular Weight: 80-83 kDa
• GenBank Accession Number: BC019027
• Gene Symbol: XRCC5
• Gene ID (NCBI): 7520
• RRID: AB_2919689
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P13010
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

There are at least two pathways for eukaryotes to repair DNA double-strand breaks: homologous recombination and nonhomologous end joining(NHEJ). The core NHEJ machinery includes XRCC4, DNA ligase IV and the DNA-dependent protein kinase complex, which consists of the DNA end-binding XRCC5/XRCC6 heterodimer and the catalytic subunit PRKDC. The heterdimer of XRCC5/XRCC6 enhanced teh affinity of the catalytic subunit PRKDC to DNA by 100-fold. Once the XRCC5/6 dimer association with NAA15, it can bind to the osteocalcin promoter and activate osteocalcin expression. The XRCC5/6 dimer acts as a negative regulator of transcription when together with APEX1. Some publised papers indicated that the MW of XRCC5 is 86kDa, while more papers suggested that XRCC5 is a 80kDa protein, as it was firstly introducted in publication. Thus, Ku80 and Ku86 are the same protein.