Tested Applications
Positive WB detected in | HeLa cells, BGC-823 cells, MCF-7 cells, HepG2 cells, SGC-7901 cells, mouse liver tissue, rat liver tissue |
Positive IP detected in | NIH/3T3 cells |
Positive IHC detected in | human liver cancer tissue, human ovary tumor tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human lung cancer tissue |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 36 publications below |
WB | See 271 publications below |
IHC | See 74 publications below |
IF | See 120 publications below |
IP | See 14 publications below |
CoIP | See 21 publications below |
ChIP | See 1 publications below |
Product Information
13584-1-AP targets YAP1 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4510 Product name: Recombinant human YAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 155-504 aa of BC038235 Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL Predict reactive species |
Full Name | Yes-associated protein 1, 65kDa |
Calculated Molecular Weight | 504 aa, 54 kDa |
Observed Molecular Weight | 65-75 kDa |
GenBank Accession Number | BC038235 |
Gene Symbol | YAP1 |
Gene ID (NCBI) | 10413 |
RRID | AB_2218915 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P46937 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Yes-associated protein 1 (YAP1) is a transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).Increased expression seen in some liver and prostate cancers (PMID: 31613226, 32488048, 33520338). Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).It is actived by phosphorylation and degradated by ubiquitination (PMID: 20048001).This antibody is a rabbit polyclonal antibody. The calcualted molecular weight of YAP1 is 54 kDa, but routinely observed at 65-75 kDa by Western Blot (PMID: 28230103, 33264286, 36255405).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for YAP1 antibody 13584-1-AP | Download protocol |
IHC protocol for YAP1 antibody 13584-1-AP | Download protocol |
IF protocol for YAP1 antibody 13584-1-AP | Download protocol |
IP protocol for YAP1 antibody 13584-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Mater Reprogramming normal cells into tumour precursors requires ECM stiffness and oncogene-mediated changes of cell mechanical properties. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Udesh (Verified Customer) (06-17-2025) | Worked well for IF and WB
|
FH Kis (Verified Customer) (02-21-2025) | This antibody performs well for both Western blot (WB) and immunohistochemistry (IHC) in human and mouse models.
|
FH Kazuaki (Verified Customer) (01-28-2025) | Works well
|
FH Siddharth (Verified Customer) (08-04-2023) | Great for IF. Detects both Cytoplasmic and Nuclear YAP1.
![]() |
FH Chiara (Verified Customer) (09-15-2022) | In RH4 cells I observe by Western blot 4 bands; two bands around 70 KDa correspond to YAP, while a single band around 55 KDa corresponds to TAZ protein as proved by a RNA interference experiment.
![]() |
FH María (Verified Customer) (02-08-2022) | Works for WB (1:1000).
|
FH Arianna (Verified Customer) (03-01-2019) | Genetically validated on YAP-null liver sections.
|
FH Joshua (Verified Customer) (12-20-2018) | Cells were fixed in 4% paraformaldehyde and stained overnight at 4C. Cells were counterstained with DAPI and phalloidin. Stain was mix of nuclear, cytosolic, and junctional.
![]() |
FH Joshua (Verified Customer) (12-20-2018) | Cells were fixed in 4% paraformaldehyde and stained overnight at 4C. Cells were counterstained with phalliodin and DAPI. Staining is mix of nuclear, junctional, and cytosolic.
![]() |
FH Juan Pablo (Verified Customer) (11-29-2018) | CGN treated with Shh (1ug/ml) for 48hs to induced proliferation, I see a nice induction of YAP1I get a nice clean band
![]() |
FH kk (Verified Customer) (11-21-2018) |
|