Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

YTHDF1 Polyclonal antibody

YTHDF1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 17479-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA

C20orf21, DACA-1, DF1, YTH domain-containing family protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, A549 cells, mouse brain tissue, rat brain tissue, HEK-293 cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman kidney tissue, human hypothalamus tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17479-1-AP targets YTHDF1 in WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, zebrafish, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11509

Product name: Recombinant human YTHDF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 210-559 aa of BC050284

Sequence: VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ

Predict reactive species
Full Name YTH domain family, member 1
Calculated Molecular Weight 559 aa, 61 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC050284
Gene Symbol YTHDF1
Gene ID (NCBI) 54915
RRIDAB_2217473
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BYJ9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YTHDF1, also named YTH domain-containing family protein 1 or C20orf21, is a 559 amino acid protein, which localizes in the cytoplasm. YTHDF1 specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency. M6A is a modification present at the internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing, and stability. YTHDF1 acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation. YTHDF1 exists two isoforms and the calculated molecular weight of isoforms are 61 kDa and 21 kDa.

Protocols

Product Specific Protocols
IF protocol for YTHDF1 antibody 17479-1-APDownload protocol
IHC protocol for YTHDF1 antibody 17479-1-APDownload protocol
IP protocol for YTHDF1 antibody 17479-1-APDownload protocol
WB protocol for YTHDF1 antibody 17479-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Signal Transduct Target Ther

m6A demethylase ALKBH5 is required for antibacterial innate defense by intrinsic motivation of neutrophil migration.

Authors - Yang Liu
mouse,humanWB

Signal Transduct Target Ther

HIF-1α-induced expression of m6A reader YTHDF1 drives hypoxia-induced autophagy and malignancy of hepatocellular carcinoma by promoting ATG2A and ATG14 translation.

Authors - Qing Li
  • KO Validated
mouseWB,IF

Nature

m6A facilitates hippocampus-dependent learning and memory through YTHDF1.

Authors - Hailing Shi
  • KO Validated
mouseWB,IP

Nature

Anti-tumour immunity controlled through mRNA m6A methylation and YTHDF1 in dendritic cells.

Authors - Dali Han
  • KO Validated
humanIF

Nature

m6A enhances the phase separation potential of mRNA.

Authors - Ryan J Ries
mouseWB

Nature

m6A RNA methylation regulates the fate of endogenous retroviruses.

Authors - Tomasz Chelmicki

Reviews

    4.7 out of 5
Add a review

10 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Mounika (Verified Customer) (12-25-2025)

Antibodies are excellent, visibility is goog

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:800

Vikas (Verified Customer) (12-23-2024)

Works very good. used for WB.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293T

RASHMI (Verified Customer) (11-27-2024)

Works great in WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293

Fanpeng (Verified Customer) (03-14-2024)

Good for immunostaining and WB analysis using brain tissues and multiple brain cells.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:2000 WB, 1:200 IHC/IF
  • Cell Tissue Type: human brain/M17 cell/primary mouse brain cells

Tatyana (Verified Customer) (12-04-2023)

Works well in WB and also gives a cytoplasmic signal in ICC, although it is fairly week. Also works in PLA.

  • Applications: Western Blot, Immunofluorescence, Other
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa and SH-SY5Y cells
YTHDF1 Antibody Western Blot,Immunofluorescence,Other validation (1:1000 dilution) in HeLa and SH-SY5Y cells (Cat no:17479-1-AP)

Shinford (Verified Customer) (10-26-2023)

We conducted tests on various m6A-related modulators, and the antibodies related to the YTHDF family consistently performed well. Even at a lower concentration of 1:3000, they yielded satisfactory results.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Cancer cell lines
YTHDF1 Antibody Western Blot validation (1:2000 dilution) in Cancer cell lines (Cat no:17479-1-AP)

Sarah (Verified Customer) (01-05-2021)

Works great in WB at 1/1000 (5% Milk TBS Tween). Tested on HeLa and 293T lysates;

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa and HEL293T

Hannah (Verified Customer) (08-14-2020)

Band observed by WB of correct size that is reduced with siRNA knockdown but required long exposure or Pico supersignal ECL for a good signal from fibroblast lysates

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1/1000 for WB; 1/100 for IF
  • Cell Tissue Type: human fibroblasts

Biao (Verified Customer) (03-11-2020)

This antibody is very specific and good quality.

  • Applications: Western Blot,
  • Cell Tissue Type: hct-116

Zizhao (Verified Customer) (12-03-2018)

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HaCaT/human keratinocytes
YTHDF1 Antibody Western Blot, validation (1:1000 dilution) in HaCaT/human keratinocytes (Cat no:17479-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...