Recombinant human ZBTB24 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag24458
Synonyms
BIF1; PATZ2; ZNF450
Validation Data Gallery View All
Product Information
| Peptide Sequence |
SNKKNDPPKRKRGRPKKVNTLQEEKSELAAEEEIQLRVNNSVQNRQNFVVKGDSGVLNEQIAAKEKEESEPTCEPSREEEMPVEKDENYDPKTEDGQASQSRYSKRRIWRSVKLKDYKLVGDQEDHGSAKRICGRRKRPGGPEARCKDCGKVFKYNHFLAIHQRSHTGNDVFKADCSVLQNWE
(151-333 aa encoded by BC036731) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
