Recombinant human ZNF202 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag23859
Synonyms
ZNF202, Zinc finger protein 202, ZKSCAN10
Validation Data Gallery View All
Product Information
| Peptide Sequence |
FKDVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDIQEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCSVCGKSFTCNSHLVRHL
(239-416 aa encoded by BC013382) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
