ZNF451 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 25228-1-AP (same clone as 25228-1-PBS)

  WB result of ZNF451 antibody (25228-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZNF451 transfected HeLa cells. This data was developed using the same antibody clone with 25228-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 25228-1-AP (same clone as 25228-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25228-1-AP (ZNF451 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25228-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25228-1-AP (same clone as 25228-1-PBS)

  IP result of anti-ZNF451 (IP:25228-1-AP, 4ug; Detection:25228-1-AP 1:300) with HeLa cells lysate 1080 ug. This data was developed using the same antibody clone with 25228-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25228-1-AP (same clone as 25228-1-PBS)

  IP result of anti-ZNF451 (IP:25228-1-AP, 4ug; Detection:25228-1-AP 1:300) with HeLa cells lysate 4000ug. This data was developed using the same antibody clone with 25228-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25228-1-AP (same clone as 25228-1-PBS)

  IP result of anti-ZNF451 (IP:25228-1-AP, 4ug; Detection:25228-1-AP 1:300) with HeLa cells lysate 1080 ug. This data was developed using the same antibody clone with 25228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 25228-1-AP (same clone as 25228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25228-1-AP (ZNF451 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 25228-1-AP (same clone as 25228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25228-1-AP (ZNF451 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25228-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 25228-1-AP (same clone as 25228-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 25228-1-AP (ZNF451 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25228-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZNF451 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 25228-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

25228-1-PBS targets ZNF451 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18346

  Product name: Recombinant human ZNF451 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC021712

  Sequence: MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSYTDENIKRKDHIDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEFIRGHSDTEAARLCVDQWLKMPGLKTGTINCGTKSSFRRGGHTWVSGKPILCPIMHCNKEFDNGHLLLGHLKRFDHSPCDPTITLHGPFFSSFACVVCYKKFVTQQQYRDHLFDKEATDDGHNNNLLPQIIQCFACPNCFLLFSRKEECSKHMSGKNHFHQSFKLGDNKGIAHPISFPSFAKKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKS

• Full Name: zinc finger protein 451
• Calculated Molecular Weight: 1061 aa, 121 kDa
• Observed Molecular Weight: 121 kDa
• GenBank Accession Number: BC021712
• Gene Symbol: ZNF451
• Gene ID (NCBI): 26036
• RRID: AB_2879975
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4E5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.