Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse cerebellum tissue, human brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 2 publications below |
| IF | See 2 publications below |
Product Information
66412-1-Ig targets Alpha Synuclein in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1285 Product name: Recombinant human a-Synuclein protein Source: e coli.-derived, PKG Tag: GST Domain: 1-140 aa of BC013293 Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Predict reactive species |
| Full Name | synuclein, alpha (non A4 component of amyloid precursor) |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 18-19 kDa |
| GenBank Accession Number | BC013293 |
| Gene Symbol | Alpha Synuclein |
| Gene ID (NCBI) | 6622 |
| RRID | AB_2881784 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P37840 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Alpha Synuclein antibody 66412-1-Ig | Download protocol |
| IHC protocol for Alpha Synuclein antibody 66412-1-Ig | Download protocol |
| WB protocol for Alpha Synuclein antibody 66412-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Appl Microbiol Biotechnol The alteration of intestinal mucosal α-synuclein expression and mucosal microbiota in Parkinson's disease | ||
Biomed Pharmacother Nardosinone regulates the slc38a2 gene to alleviate Parkinson's symptoms in rats through the GABAergic synaptic and cAMP pathways. | ||
J Neuropathol Exp Neurol Regular Aerobic Exercise-Alleviated Dysregulation of CAMKIIα Carbonylation to Mitigate Parkinsonism via Homeostasis of Apoptosis With Autophagy. | ||
NPJ Parkinsons Dis Urea cycle dysregulation drives metabolic stress and neurodegeneration in Parkinson's disease | ||
Nat Commun DNA nanoflower Oligo-PROTAC for targeted degradation of FUS to treat neurodegenerative diseases |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Boyan (Verified Customer) (01-13-2026) | very weak band around the expected molecular weight
|
FH Janelle (Verified Customer) (09-12-2022) | Perfect for WB!
|
FH BISHR (Verified Customer) (05-10-2022) | I used it in WB with 1:1000 ration, the band was clear and almost perfect. However, it says the expected kd ranges from 14 to 18, unfortunately I am getting far higher bands up to 50 kd sometimes. Although I am using concentrated acrylamide in the gel, it is making it difficult for reviewers to understand that.
![]() |
FH q (Verified Customer) (01-05-2022) | It is good in WB with a specific band at 17 kd around.
![]() |
FH Sheela (Verified Customer) (07-16-2019) | This product worked as expected
![]() |






















