Alpha Synuclein Monoclonal antibody, PBS Only (Detector)

Alpha Synuclein Monoclonal Antibody for WB, IHC, IF-P, Sandwich ELISA, Indirect ELISA
Cat No. 66412-1-PBS
Clone No.1B10E9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Sandwich ELISA, Indirect ELISA

1, a-synuclein, SNCA, 1B10E9, alpha syn

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66412-1-PBS targets Alpha Synuclein as part of a matched antibody pair:

MP50043-1: 60285-1-PBS capture and 66412-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1285

Product name: Recombinant human a-Synuclein protein

Source: e coli.-derived, PKG

Tag: GST

Domain: 1-140 aa of BC013293

Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Predict reactive species
Full Name synuclein, alpha (non A4 component of amyloid precursor)
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 18-19 kDa
GenBank Accession NumberBC013293
Gene Symbol Alpha Synuclein
Gene ID (NCBI) 6622
RRIDAB_2881784
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP37840
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.

Loading...
||
New chat Able
正在加载,请稍候...