Recombinant human pan-PAX protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag16018
Synonyms
PAX8, PAX-8, paired box 8, Paired box protein Pax 8, Paired box protein Pax-8
Validation Data Gallery View All
Product Information
| Peptide Sequence |
HGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF
(10-140 aa encoded by BC001060) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
