AADAT Polyclonal antibody

AADAT Polyclonal Antibody for IHC, ELISA
Cat No. 13031-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

IHC, IF, ELISA

2 aminoadipate transaminase, 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, Alpha-aminoadipate aminotransferase, aminoadipate aminotransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse cerebellum tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13031-1-AP targets AADAT in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3676

Product name: Recombinant human AADAT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 81-429 aa of BC031068

Sequence: SAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

Predict reactive species
Full Name aminoadipate aminotransferase
Calculated Molecular Weight 429 aa, 48 kDa
GenBank Accession NumberBC031068
Gene Symbol AADAT
Gene ID (NCBI) 51166
RRIDAB_2877904
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N5Z0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AADAT (alpha-aminoadipate aminotransferase), also known as KAT (kynurenine aminotransferase) II, is a primary enzyme in the brain for catalysing the transamination of kynurenine to KYNA (kynurenic acid). KYNA is the only known endogenous antagonist of the N-methyl-D-aspartate receptor. AADAT is also involved in lysine metabolism by catalyzing the transamination of aminoadipate to a-ketoadipate (PMID: 17024659, 18056995). The human AADAT enzyme is also predicted to contain a mitochondrial cleavage signal, suggesting that AADAT is a mitochondrial protein (PMID: 19826765).

Protocols

Product Specific Protocols
IHC protocol for AADAT antibody 13031-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Brain Struct Funct

Astrocytic and neuronal localization of kynurenine aminotransferase-2 in the adult mouse brain.

Authors - Judit Herédi
mouseIHC

Neurochem Int

Species-specific neuronal localization of kynurenine aminotransferase-2 in the mouse cerebellum.

Authors - Emma Balog

J Clin Med

Impaired Skeletal Muscle Kynurenine Metabolism in Patients with Chronic Obstructive Pulmonary Disease.

Authors - Harry R Gosker
monkeyIF

bioRxiv

Kynurenic acid inflammatory signaling expands in primates and impairs prefrontal cortical cognition

Authors - Shengtao Yang
mouseIHC,IF

Cell Commun Signal

Helicobacter pylori promotes gastric intestinal metaplasia through activation of IRF3-mediated kynurenine pathway

Authors - Xinhua Liang
Loading...
||
New chat Able
正在加载,请稍候...