Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, HT-29 cells, Caco-2 cells, THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IF | See 1 publications below |
Product Information
66697-1-Ig targets ABCD3 in WB, IF, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG3 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24760 Product name: Recombinant human ABCD3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-124 aa of BC068509 Sequence: MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKR Predict reactive species |
| Full Name | ATP-binding cassette, sub-family D (ALD), member 3 |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC068509 |
| Gene Symbol | ABCD3 |
| Gene ID (NCBI) | 5825 |
| RRID | AB_2882050 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P28288 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ABCD3 antibody 66697-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation | ||
Hypertens Res Metabolic phenotypes and fatty acid profiles associated with histopathology of primary aldosteronism | ||
Life Sci Alliance Non-canonical activation of the ER stress sensor ATF6 by Legionella pneumophila effectors | ||
Chin J Nat Med Activation of LONP1 by 84-B10 alleviates aristolochic acid nephropathy via re-establishing mitochondrial and peroxisomal homeostasis | ||
Haematologica Dimeric ferrochelatase bridges ABCB7 and ABCB10 homodimers in an architecturally defined molecular complex required for heme biosynthesis. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH PAULA (Verified Customer) (07-12-2023) | I tested this ABCD3 antibody at two dilutions on THP1 cells (20ug cell lysate) and I saw a nice band around 70 kDa, although some non-specific bands were also detected. Dilution 1:1000 showed similar results to 1:500 dilution.
![]() |


