Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, HT-29 cells, Caco-2 cells, THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66697-1-Ig targets ABCD3 in WB, IF, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG3 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24760 Product name: Recombinant human ABCD3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-124 aa of BC068509 Sequence: MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKR Predict reactive species |
| Full Name | ATP-binding cassette, sub-family D (ALD), member 3 |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC068509 |
| Gene Symbol | ABCD3 |
| Gene ID (NCBI) | 5825 |
| RRID | AB_2882050 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P28288 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ABCD3 antibody 66697-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
ABCD3 Monoclonal antibody (1G7G5), catalog number 66697-1-Ig, has 8 total citations. These appear in journals including Molecular Cell, Haematologica, Chinese Journal of Natural Medicines, Analytical Chemistry, Journal of Cell Biology, Hypertension Research, Life Science Alliance, and bioRxiv. Research fields span viral–inflammasome interactions, heme biosynthesis, peroxisome homeostasis and pexophagy, lysosome biology, nephropathy, metabolic phenotypes in aldosteronism, and ER stress responses to bacterial infection.
| Species | Application | Title |
|---|---|---|
Mol Cell An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation | ||
Haematologica Dimeric ferrochelatase bridges ABCB7 and ABCB10 homodimers in an architecturally defined molecular complex required for heme biosynthesis. | ||
Chin J Nat Med Activation of LONP1 by 84-B10 alleviates aristolochic acid nephropathy via re-establishing mitochondrial and peroxisomal homeostasis | ||
Anal Chem Benchmarking Lysosome Enrichment Methods: A Guide for Research and Clinical Translation. | ||
J Cell Biol The p97 ATPase and its adaptor UBXD8 maintain peroxisome pools by preventing pexophagy. | ||
Hypertens Res Metabolic phenotypes and fatty acid profiles associated with histopathology of primary aldosteronism |
Reviews
What customers say
A user tested this ABCD3 antibody by Western Blot on THP1 cell lysate at 1:500 and 1:1000 dilutions. A clear band appeared around 70 kDa, though some non-specific bands were also observed. Both dilutions yielded similar results. The reviewer rated the product 4 out of 5 stars, indicating overall satisfaction with performance while noting minor non-specific binding.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
PAULA (Verified Customer) (07-12-2023) | I tested this ABCD3 antibody at two dilutions on THP1 cells (20ug cell lysate) and I saw a nice band around 70 kDa, although some non-specific bands were also detected. Dilution 1:1000 showed similar results to 1:500 dilution.
 |
