Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, L02 cells, mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22214-1-AP targets ACP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17539 Product name: Recombinant human ACP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 15-102 aa of BC007422 Sequence: GNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNR Predict reactive species |
| Full Name | acid phosphatase 1, soluble |
| Calculated Molecular Weight | 158 aa, 18 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC007422 |
| Gene Symbol | ACP1 |
| Gene ID (NCBI) | 52 |
| RRID | AB_2879032 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24666 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human red cell acid phosphatase (ACP1) is a polymorphic enzyme closely related to cytosolic low molecular weight acid phosphatases, a protein family broadly conserved among eukaryotes. It catalyses the transfer of phosphate from phosphate ester substrates to suitable acceptor alcohols such as methanol and glycerol. This protein has 3 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ACP1 antibody 22214-1-AP | Download protocol |
| WB protocol for ACP1 antibody 22214-1-AP | Download protocol |
| IF protocol for ACP1 antibody 22214-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACP1 polyclonal antibody (Cat# 22214-1-AP) has 2 citations. One appears in Nature Communications (IF 18.1), studying stress-induced ribonucleoprotein granule dynamics using IF in human samples, falling under cell biology and stress granule research. The other is published in Research in Veterinary Science (IF 2.1), applying WB for DIA-based serum proteomics in goat pregnancy biomarker discovery, related to veterinary proteomics and reproductive biology.
| Species | Application | Title |
|---|---|---|
Nat Commun Intracellular energy controls dynamics of stress-induced ribonucleoprotein granules | ||
