Tested Applications
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
27231-1-AP targets ALMS1 in IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26100 Product name: Recombinant human ALMS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2881-3000 aa of NM_015120 Sequence: LEQRELFEQSKAPRADDHVRKHHSPSPQHQDYVAPDLPSCIFLEQRELFEQCKAPYVDHQMRENHSPLPQGQDSIASDLPSPISLEQCQSKAPGVDDQMNKHHFPLPQGQDCVVEKNNQH Predict reactive species |
Full Name | Alstrom syndrome 1 |
Calculated Molecular Weight | 461 kDa |
GenBank Accession Number | NM_015120 |
Gene Symbol | ALMS1 |
Gene ID (NCBI) | 7840 |
RRID | AB_2880812 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TCU4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ALMS1 (Alstrom syndrome protein 1) is also KIAA0328. ALMS1 encodes a ~ 0.5 megadalton protein that localises to the base of centrioles. Some studies have suggested a role for this protein in maintaining centriole-nucleated sensory organelles termed primary cilia, and AS is now considered to belong to the growing class of human genetic disorders linked to ciliary dysfunction (ciliopathies). The ALMS1 protein is a component of the centrosome (PMID:30421101). ALMS1 is involved in PCM1-dependent intracellular transport. ALMS1 is required, directly or indirectly, for the localization of NCAPD2 to the proximal ends of centrioles. It is required for proper formation and/or maintenance of primary cilia (PC), microtubule-based structures that protrude from the surface of epithelial cells.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for ALMS1 antibody 27231-1-AP | Download protocol |
FC protocol for ALMS1 antibody 27231-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |