Tested Applications
Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
Positive IP detected in | mouse skeletal muscle tissue |
Positive IHC detected in | human skeletal muscle tissue, human heart tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:20000-1:100000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 10 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
22361-1-AP targets ATP2A1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, pig, chicken |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17944 Product name: Recombinant human ATP2A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 561-635 aa of BC037354 Sequence: RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG Predict reactive species |
Full Name | ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 |
Calculated Molecular Weight | 1001 aa, 110 kDa |
Observed Molecular Weight | 116 kDa |
GenBank Accession Number | BC037354 |
Gene Symbol | ATP2A1 |
Gene ID (NCBI) | 487 |
RRID | AB_2879089 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | O14983 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP2A1 also known as SERCA1, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen and is involved in muscular excitation and contraction. Mutations in ATP2A1 cause some autosomal recessive forms of Brody disease(PMID: 23911890, 10914677).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for ATP2A1 antibody 22361-1-AP | Download protocol |
IP protocol for ATP2A1 antibody 22361-1-AP | Download protocol |
WB protocol for ATP2A1 antibody 22361-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Mol Sci The Effects of Aging on Sarcoplasmic Reticulum-Related Factors in the Skeletal Muscle of Mice | ||
Metallomics Thioredoxin silencing-induced cardiac supercontraction occurs through endoplasmic reticulum stress and calcium overload in chicken. | ||
Physiol Behav Exposure to melamine cyanuric acid in adult mice caused motor activity and skeletal muscle energy metabolism disorder | ||
J Muscle Res Cell Motil Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes. | ||
Mol Ther Nucleic Acids lnc-3215 Suppression Leads to Calcium Overload in Selenium Deficiency-Induced Chicken Heart Lesion via the lnc-3215-miR-1594-TNN2 Pathway. |