Tested Applications
| Positive WB detected in | rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
Product Information
25316-1-AP targets ATP6V1G2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18007 Product name: Recombinant human ATP6V1G2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-118 aa of BC119726 Sequence: AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA Predict reactive species |
| Full Name | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2 |
| Calculated Molecular Weight | 118 aa, 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC119726 |
| Gene Symbol | ATP6V1G2 |
| Gene ID (NCBI) | 534 |
| RRID | AB_2880027 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95670 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ATP6V1G2 antibody 25316-1-AP | Download protocol |
| WB protocol for ATP6V1G2 antibody 25316-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Microbiol The interferon-inducible isoform of NCOA7 inhibits endosome-mediated viral entry. | ||
EBioMedicine A GBM-like V-ATPase signature directs cell-cell tumor signaling and reprogramming via large oncosomes. | ||
EBioMedicine Specific V-ATPase expression sub-classifies IDHwt lower-grade gliomas and impacts glioma growth in vivo. | ||
Proc Natl Acad Sci U S A Oxr1 and Ncoa7 regulate V-ATPase to achieve optimal pH for glycosylation within the Golgi apparatus and trans-Golgi network |





