Published Applications
| WB | See 1 publications below |
Product Information
25850-1-AP targets BCL2L2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23125 Product name: Recombinant human BCL2L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC021198 Sequence: MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF Predict reactive species |
| Full Name | BCL2-like 2 |
| Calculated Molecular Weight | 193 aa, 21 kDa |
| GenBank Accession Number | BC021198 |
| Gene Symbol | BCL2L2 |
| Gene ID (NCBI) | 599 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92843 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
