Recombinant human BEST1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag15129
Synonyms
ARB; BEST; BMD; TU15B; VMD2
Validation Data Gallery View All
Product Information
| Peptide Sequence |
ANSRTKLLWPKRESLLHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS
(319-498 aa encoded by BC015220) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
