Filter: AllWBIPIHC

WB analysis using 13198-2-AP
Various lysates were subjected to SDS PAGE followed by western blot with 13198-2-AP (CA1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of mouse spleen using 13198-2-AP
mouse spleen tissue were subjected to SDS PAGE followed by western blot with 13198-2-AP (CA1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
WB analysis of rat spleen using 13198-2-AP
rat spleen tissue were subjected to SDS PAGE followed by western blot with 13198-2-AP (CA1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
WB analysis of Jurkat using 13198-2-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 13198-2-AP (CA1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis using 13198-2-AP
Various lysates were subjected to SDS PAGE followed by western blot with 13198-2-AP (CA1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
IP experiment of K-562 using 13198-2-AP
IP result of anti-CA1 (IP:13198-2-AP, 4ug; Detection:13198-2-AP 1:500) with K-562 cells lysate 1200ug.
IHC staining of human breast cancer using 13198-2-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13198-2-AP (CA1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 13198-2-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13198-2-AP (CA1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 13198-2-AP
Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 13198-2-AP (CA1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Featured Product
KD/KO Validated

Carbonic anhydrase 1/CA1 Polyclonal antibody

Name: Carbonic anhydrase 1/CA1 Polyclonal antibody
Brand: Proteintech
SKU: 13198-2-AP
Rating: 5.00 (1 reviews)

Carbonic anhydrase 1/CA1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13198-2-AP

Publications(10)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CA1, CA I, Carbonate dehydratase I, Car1, CA-I

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (10)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse spleen tissue, Jurkat cells, rat spleen tissue
Positive IP detected in	K-562 cells
Positive IHC detected in	human breast cancer tissue, human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 7 publications below
IHC	See 1 publications below
IF	See 4 publications below
IP	See 1 publications below

Product Information

13198-2-AP targets Carbonic anhydrase 1/CA1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3932 Product name: Recombinant human CA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC027890 Sequence: MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF Predict reactive species
Full Name	carbonic anhydrase I
Calculated Molecular Weight	261 aa, 29 kDa
Observed Molecular Weight	29 kDa
GenBank Accession Number	BC027890
Gene Symbol	CA1
Gene ID (NCBI)	759
RRID	AB_2275041
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P00915
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CA1(Carbonic anhydrase 1) is also named as CAB and belongs to the alpha-carbonic anhydrase family, which may reside in cytoplasm, in mitochondria, or in secretory granules, or associate with membranes in cell. It forms a large family of genes encoding zinc metalloenzymes of great physiologic importance. Extracellular CA1 mediates hemorrhagic retinal and cerebral vascular permeability through prekallikrein activation(PMID:17259996).

Protocols

Product Specific Protocols
IHC protocol for Carbonic anhydrase 1/CA1 antibody 13198-2-AP	Download protocol
IP protocol for Carbonic anhydrase 1/CA1 antibody 13198-2-AP	Download protocol
WB protocol for Carbonic anhydrase 1/CA1 antibody 13198-2-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
mouse,rat	WB,IF	Acta Neuropathol Commun Upregulation of carbonic anhydrase 1 beneficial for depressive disorder Authors - Ke Cheng KO Validated View Article
rat	WB	J Ginseng Res Ginsenoside Rg1 attenuates mechanical stress-induced cardiac injury via calcium sensing receptor-related pathway Authors - Mei-Li Lu View Article
mouse	IF	FASEB J Loss of interleukin-10 receptor disrupts intestinal epithelial cell proliferation and skews differentiation towards the goblet cell fate. Authors - Brittany R Jenkins View Article
human	WB	J Inflamm Res M1-Type Macrophages Secrete TNF-α to Stimulate Vascular Calcification by Upregulating CA1 and CA2 Expression in VSMCs Authors - Xianqin Song View Article
mouse	WB	Am J Physiol Lung Cell Mol Physiol Carbonic anhydrase and soluble adenylate cyclase regulation of cystic fibrosis cellular phenotypes. Authors - Kathleen Boyne View Article
human,rat	WB	Front Pharmacol Calcium Sensing Receptor-Related Pathway Contributes to Cardiac Injury and the Mechanism of Astragaloside IV on Cardioprotection. Authors - Meili Lu View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Brittany (Verified Customer) (09-27-2019)

Using the CA-1 primary antibody with mouse colon scrapes yielded very clean bands with western blotting. Immunofluorescence also gave a fairly clean, detectable signal, with CA-1 showing up along the brush border in mouse colon tissue. There were some cells that stained more intracellularly, and unsure if that was non-specific binding of the antibody, or another cell type other than colonocytes that expresses CA-1 intracellularly.