Tested Applications
| Positive WB detected in | HeLa cells, rat pancreas tissue, HepG2 cells, MCF-7 cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11026-1-AP targets CDK4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, zebrafish, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1505 Product name: Recombinant human CDK4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC010153 Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Predict reactive species |
| Full Name | cyclin-dependent kinase 4 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 30-34 kDa |
| GenBank Accession Number | BC010153 |
| Gene Symbol | CDK4 |
| Gene ID (NCBI) | 1019 |
| RRID | AB_2078702 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11802 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1- to S-phase transition during the cell cycle and its expression is primarily controlled at the transcriptional level(PMID:17253961). CCND1-CDK4 axis is not only critical in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment that are vital to sustain tumor outgrowth(PMID:21844184).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CDK4 antibody 11026-1-AP | Download protocol |
| IF protocol for CDK4 antibody 11026-1-AP | Download protocol |
| IHC protocol for CDK4 antibody 11026-1-AP | Download protocol |
| IP protocol for CDK4 antibody 11026-1-AP | Download protocol |
| WB protocol for CDK4 antibody 11026-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CDK4 Polyclonal antibody (Cat# 11026-1-AP) has accumulated 572 citations. Publications appear in high-impact journals including Nature, Nature Communications, Molecular Cancer, Cancer Research, Cell Death & Disease, Science Advances, Oncogene, Journal of Medicinal Chemistry, and European Journal of Medicinal Chemistry. Research fields span oncology (breast, lung, gastric, colorectal, liver, and bladder cancers), cell cycle regulation, targeted drug discovery, immunotherapy, epigenetics, and cardiovascular biology.
| Species | Application | Title |
|---|---|---|
Mol Cancer The circACTN4 interacts with FUBP1 to promote tumorigenesis and progression of breast cancer by regulating the expression of proto-oncogene MYC. | ||
Mol Cancer S6K1 amplification confers innate resistance to CDK4/6 inhibitors through activating c-Myc pathway in patients with estrogen receptor-positive breast cancer | ||
Mol Cancer CDK6/4 inactivates BAP1 deubiquitinase destabilizing VHL to promote metastatic colonization in liver. | ||
Mol Cancer Circular RNA BCRC-3 suppresses bladder cancer proliferation through miR-182-5p/p27 axis. | ||
Mol Cancer Long non-coding RNA PVT1 promotes tumor progression by regulating the miR-143/HK2 axis in gallbladder cancer. |
Reviews
What customers say
One customer (Prakash C.) reviewed this antibody in October 2025, using it for Western Blot on bladder tissue (Lot 00113795). They rated it 4 out of 5 stars and commented that it produced a "very good band" in their Western Blot experiment. Overall, the single review reflects positive satisfaction with the antibody's performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Prakash (Verified Customer) (10-28-2025) | very good band in western blot
|

























