Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CDK4 Polyclonal antibody

CDK4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA

Cell division protein kinase 4, CMM3, cyclin dependent kinase 4, Cyclin-dependent kinase 4, EC:2.7.11.22

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CDK4 in ?

Tested Applications

Positive WB detected inHeLa cells, rat pancreas tissue, HepG2 cells, MCF-7 cells, NIH/3T3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11026-1-AP targets CDK4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, zebrafish, bovine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1505

Product name: Recombinant human CDK4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-303 aa of BC010153

Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Predict reactive species
Full Name cyclin-dependent kinase 4
Calculated Molecular Weight 34 kDa
Observed Molecular Weight30-34 kDa
GenBank Accession NumberBC010153
Gene Symbol CDK4
Gene ID (NCBI) 1019
RRIDAB_2078702
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP11802
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1- to S-phase transition during the cell cycle and its expression is primarily controlled at the transcriptional level(PMID:17253961). CCND1-CDK4 axis is not only critical in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment that are vital to sustain tumor outgrowth(PMID:21844184).

Protocols

Product Specific Protocols
FC protocol for CDK4 antibody 11026-1-APDownload protocol
IF protocol for CDK4 antibody 11026-1-APDownload protocol
IHC protocol for CDK4 antibody 11026-1-APDownload protocol
IP protocol for CDK4 antibody 11026-1-APDownload protocol
WB protocol for CDK4 antibody 11026-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CDK4 Polyclonal antibody (Cat# 11026-1-AP) has accumulated 572 citations. Publications appear in high-impact journals including Nature, Nature Communications, Molecular Cancer, Cancer Research, Cell Death & Disease, Science Advances, Oncogene, Journal of Medicinal Chemistry, and European Journal of Medicinal Chemistry. Research fields span oncology (breast, lung, gastric, colorectal, liver, and bladder cancers), cell cycle regulation, targeted drug discovery, immunotherapy, epigenetics, and cardiovascular biology.

SpeciesApplicationTitle
mouse,humanWB

Nature

SMYD5 methylation of rpL40 links ribosomal output to gastric cancer

Authors - Juhyung Park
humanWB,IHC

Mol Cancer

The circACTN4 interacts with FUBP1 to promote tumorigenesis and progression of breast cancer by regulating the expression of proto-oncogene MYC.

Authors - Xiaosong Wang
humanWB,IF

Mol Cancer

S6K1 amplification confers innate resistance to CDK4/6 inhibitors through activating c-Myc pathway in patients with estrogen receptor-positive breast cancer

Authors - Hongnan Mo
humanWB

Mol Cancer

CDK6/4 inactivates BAP1 deubiquitinase destabilizing VHL to promote metastatic colonization in liver.

Authors - Bei Jin
humanWB

Mol Cancer

Circular RNA BCRC-3 suppresses bladder cancer proliferation through miR-182-5p/p27 axis.

Authors - Fei Xie
humanWB

Mol Cancer

Long non-coding RNA PVT1 promotes tumor progression by regulating the miR-143/HK2 axis in gallbladder cancer.

Authors - Jianan Chen

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One customer (Prakash C.) reviewed this antibody in October 2025, using it for Western Blot on bladder tissue (Lot 00113795). They rated it 4 out of 5 stars and commented that it produced a "very good band" in their Western Blot experiment. Overall, the single review reflects positive satisfaction with the antibody's performance in WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Prakash (Verified Customer) (10-28-2025)

very good band in western blot

  • Applications: Western Blot
  • Cell Tissue Type: Bladder tissue
Loading...
||
New chat

Able™

正在加载,请稍候...