Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis using 11026-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11026-1-AP (CDK4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 11026-1-AP
WB result of CDK4 antibody (11026-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CDK4 transfected HeLa cells.
WB analysis of rat pancreas using 11026-1-AP
rat pancreas tissue were subjected to SDS PAGE followed by western blot with 11026-1-AP (CDK4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis using 11026-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11026-1-AP (CDK4 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.
IP experiment of HeLa using 11026-1-AP
IP result of anti-CDK4 (IP:11026-1-AP, 3ug; Detection:11026-1-AP 1:1000) with HeLa cells lysate 4000ug.
IHC staining of human lung cancer using 11026-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 11026-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 11026-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 11026-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 11026-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 11026-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of MCF-7 using 11026-1-AP
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CDK4 antibody (11026-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
FC experiment of MCF-7 using 11026-1-AP
1x10^6 MCF-7 cells were intracellularly stained with 0.8 ug CDK4 Polyclonal antibody (11026-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Featured Product
KD/KO Validated

CDK4 Polyclonal antibody

CDK4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11026-1-AP

Publications(467)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA

Synonyms

Cell division protein kinase 4, CMM3, cyclin dependent kinase 4, Cyclin-dependent kinase 4, EC:2.7.11.22

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite® Plus 647 CoraLite®555

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (467)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, rat pancreas tissue, HepG2 cells, MCF-7 cells, NIH/3T3 cells
Positive IP detected in	HeLa cells
Positive IHC detected in	human lung cancer tissue, human breast cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	MCF-7 cells
Positive FC (Intra) detected in	MCF-7 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 4 publications below
WB	See 450 publications below
IHC	See 31 publications below
IF	See 10 publications below
IP	See 4 publications below
CoIP	See 3 publications below
RIP	See 1 publications below

Product Information

11026-1-AP targets CDK4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, pig, canine, zebrafish, sheep
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1505 Product name: Recombinant human CDK4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC010153 Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Predict reactive species
Full Name	cyclin-dependent kinase 4
Calculated Molecular Weight	34 kDa
Observed Molecular Weight	30-34 kDa
GenBank Accession Number	BC010153
Gene Symbol	CDK4
Gene ID (NCBI)	1019
RRID	AB_2078702
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P11802
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1- to S-phase transition during the cell cycle and its expression is primarily controlled at the transcriptional level(PMID:17253961). CCND1-CDK4 axis is not only critical in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment that are vital to sustain tumor outgrowth(PMID:21844184).

Protocols

Product Specific Protocols
IF protocol for CDK4 antibody 11026-1-AP	Download protocol
IHC protocol for CDK4 antibody 11026-1-AP	Download protocol
IP protocol for CDK4 antibody 11026-1-AP	Download protocol
WB protocol for CDK4 antibody 11026-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB,IP	Nat Commun F-box protein FBXO32 ubiquitinates and stabilizes D-type cyclins to drive cancer progression Authors - Feng Li View Article
mouse	WB	Mol Cell METTL1-mediated m7G modification of Arg-TCT tRNA drives oncogenic transformation. Authors - Esteban A Orellana View Article
human	WB,IHC	Mol Cancer The circACTN4 interacts with FUBP1 to promote tumorigenesis and progression of breast cancer by regulating the expression of proto-oncogene MYC. Authors - Xiaosong Wang View Article
human	WB	Sci Adv The p23 co-chaperone is a succinate-activated COX-2 transcription factor in lung adenocarcinoma tumorigenesis Authors - Zhenlong Yu View Article
human	WB	Nat Commun CDK5-dependent phosphorylation and nuclear translocation of TRIM59 promotes macroH2A1 ubiquitination and tumorigenicity. Authors - Youzhou Sang View Article
human	WB	Nat Commun Identification of predictors of drug sensitivity using patient-derived models of esophageal squamous cell carcinoma. Authors - Dan Su View Article