Tested Applications
Positive WB detected in | mouse liver tissue, NIH/3T3 cells, rat liver tissue |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells, SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 14 publications below |
IF | See 1 publications below |
Product Information
11460-1-AP targets COX6A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2006 Product name: Recombinant human COX6A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC007723 Sequence: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE Predict reactive species |
Full Name | cytochrome c oxidase subunit VIa polypeptide 1 |
Calculated Molecular Weight | 85 aa, 9 kDa |
Observed Molecular Weight | 9.5 kDa |
GenBank Accession Number | BC007723 |
Gene Symbol | COX6A1 |
Gene ID (NCBI) | 1337 |
RRID | AB_2085445 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P12074 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX6A1(Cytochrome c oxidase subunit 6A1, mitochondrial) is also named as COX6AL and belongs to the cytochrome c oxidase subunit 6A family.This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for COX6A1 antibody 11460-1-AP | Download protocol |
IHC protocol for COX6A1 antibody 11460-1-AP | Download protocol |
WB protocol for COX6A1 antibody 11460-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Autophagy PLK1 (polo like kinase 1)-dependent autophagy facilitates gefitinib-induced hepatotoxicity by degrading COX6A1 (cytochrome c oxidase subunit 6A1).
| ||
Elife Function of hTim8a in complex IV assembly in neuronal cells provides insight into pathomechanism underlying Mohr-Tranebjærg syndrome. | ||
Cell Death Dis O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma. | ||
Mol Cell Proteomics HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV | ||
Hum Mol Genet Pathological characterization of a novel mouse model expressing the PD-linked CHCHD2-T61I mutation. | ||
Mol Cell Proteomics HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV. |