Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12180-1-AP targets p120 Catenin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2824 Product name: Recombinant human CTNND1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 546-830 aa of BC010501 Sequence: GYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI Predict reactive species |
| Full Name | catenin (cadherin-associated protein), delta 1 |
| Calculated Molecular Weight | 948 aa, 105 kDa |
| Observed Molecular Weight | 90-120 kDa |
| GenBank Accession Number | BC010501 |
| Gene Symbol | p120 Catenin |
| Gene ID (NCBI) | 1500 |
| RRID | AB_2086267 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60716 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Catenins were discovered as proteins that are linked to the cytoplasmic domain of transmembrane cadherins (PMID: 9653641). p120 catenin, also called p120 ctn or catenin delta-1, regulates cell-cell adhesion through its interaction with the cytoplasmic tail of classical and type II cadherins. p120 catenin is a tyrosine kinase substrate implicated in cell transformation by SRC, as well as in ligand-induced receptor signaling through the EGF receptor, the PDGF receptor, and the CSF1 receptor. Different expression patterns of p120 catenin in lobular and ductal carcinomas of the breast have been reported: membrane stain for ductal carcinoma and cytoplasmic stain for lobular carcinoma (PMID: 24966968). Different isoforms of p120 catenin are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons (PMID: 19150613).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for p120 Catenin antibody 12180-1-AP | Download protocol |
| IHC protocol for p120 Catenin antibody 12180-1-AP | Download protocol |
| IP protocol for p120 Catenin antibody 12180-1-AP | Download protocol |
| WB protocol for p120 Catenin antibody 12180-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-p120-catenin antibody (Cat# 12180-1-AP) has 23 citations spanning journals including Nature Communications, Nature Human Behaviour, Advanced Science, Cell Reports, eBioMedicine, EMBO Molecular Medicine, PLoS Pathogens, and others. Research fields cover cell polarity, adherens junctions, atherosclerosis, sepsis, colitis, tumorigenesis, diabetic retinopathy, neuroprotection, cardiac regeneration, spinal cord injury, wound healing, depression, and stem cell biology. Applications include WB, IF, IP, CoIP, and IHC across human, mouse, rat, and canine species.
| Species | Application | Title |
|---|---|---|
Nat Commun Ubiquitin ligase CHFR mediated degradation of VE-cadherin through ubiquitylation disrupts endothelial adherens junctions | ||
Nat Commun Dynamic interactions between E-cadherin and Ankyrin-G mediate epithelial cell polarity maintenance | ||
Nat Hum Behav Genome-wide meta-analysis, functional genomics and integrative analyses implicate new risk genes and therapeutic targets for anxiety disorders | ||
Adv Sci (Weinh) TTK Inhibition Alleviates Postinjury Neointimal Formation and Atherosclerosis | ||
Cell Rep Med Multimodal hybrid nanozymes with antioxidant catalytic and antibiotic-free antibacterial activities for enhanced multi-target sepsis therapy. | ||
EBioMedicine NDRG2 regulates adherens junction integrity to restrict colitis and tumourigenesis. |
Reviews
What customers say
One user reviewed this antibody with a 5-star rating. They reported that it works well for immunoprecipitation, using it on mouse primary cardiac fibroblasts for both Western Blot and IP applications. The review was posted in December 2025. Overall, the feedback is positive, confirming the antibody's performance in IP-based workflows.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Harikrishnan (Verified Customer) (12-04-2025) | The antibody works well for Immunoprecipitation
|
