Tested Applications
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14811-1-AP targets DEXI in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6535 Product name: Recombinant human DEXI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC001083 Sequence: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE Predict reactive species |
| Full Name | dexamethasone-induced transcript |
| Calculated Molecular Weight | 10 kDa |
| GenBank Accession Number | BC001083 |
| Gene Symbol | DEXI |
| Gene ID (NCBI) | 28955 |
| RRID | AB_2092618 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95424 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DEXI, also named as MYLE, is a potential marker for glucocorticoid responsiveness in treated patients and may play a role in modulating the function of inflammatory proteins. It is a 95 residues acidic protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DEXI antibody 14811-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Stephen (Verified Customer) (09-10-2019) | Good Dexi antibody. Showed up our positive control cell line really well at a good solution (1:2000)
|
