Tested Applications
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14811-1-AP targets DEXI in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6535 Product name: Recombinant human DEXI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC001083 Sequence: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE Predict reactive species |
| Full Name | dexamethasone-induced transcript |
| Calculated Molecular Weight | 10 kDa |
| GenBank Accession Number | BC001083 |
| Gene Symbol | DEXI |
| Gene ID (NCBI) | 28955 |
| RRID | AB_2092618 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95424 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DEXI, also named as MYLE, is a potential marker for glucocorticoid responsiveness in treated patients and may play a role in modulating the function of inflammatory proteins. It is a 95 residues acidic protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DEXI antibody 14811-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
One reviewer (Stephen Hare) rated this antibody 4/5 stars for Western Blot on THP1 cells at a 1:2000 dilution. He described it as a good antibody that clearly detected his positive control cell line. The review was posted in September 2019 using lot 00006904.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Stephen (Verified Customer) (09-10-2019) | Good Dexi antibody. Showed up our positive control cell line really well at a good solution (1:2000)
|
