Product Information
13119-1-AP targets EPHA7 in ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3813 Product name: Recombinant human EPHA7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-279 aa of BC027940 Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK Predict reactive species |
| Full Name | EPH receptor A7 |
| Calculated Molecular Weight | 998 aa, 112 kDa |
| GenBank Accession Number | BC027940 |
| Gene Symbol | EPHA7 |
| Gene ID (NCBI) | 2045 |
| RRID | AB_2099663 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15375 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for EPHA7 antibody 13119-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

