Product Information
85128-4-RR targets Foxp3 in ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg4360 Product name: Recombinant Mouse Foxp3 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Sequence: YPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPS Predict reactive species |
| Full Name | forkhead box P3 |
| Observed Molecular Weight | 45 kDa |
| Gene Symbol | Foxp3 |
| Gene ID (NCBI) | 20371 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99JB6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXP3, also named as IPEX, JM2 and Scurfin, is a transcription factor. FOXP3 plays a critical role in the control of immune response. Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) which also known as X-linked autoimmunity-immunodeficiency syndrome.
