GEMIN4 Polyclonal antibody

GEMIN4 Polyclonal Antibody for WB, IP, ELISA
Cat No. 12408-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

GEMIN4, HC56, HCAP1, HHRF 1, p97

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells
Positive IP detected inHEK-293 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12408-1-AP targets GEMIN4 in WB, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3099

Product name: Recombinant human GEMIN4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 703-1058 aa of BC020062

Sequence: QLLDRFSKYWQLPKEKRCLSLDRKDLAIHILELLCEIVSANAETFSPDVWIKSLSWLHRKLEQLDWTVGLRLKSFFEGHFKCEVPATLFEICKLSEDEWTSQAHPGYGAGTGLLAWMECCCVSSGISERMLSLLVVDVGNPEEVRLFSKGFLVALVQVMPWCSPQEWQRLHQLTRRLLEKQLLHVPYSLEYIQFVPLLNLKPFAQELQLSVLFLRTFQFLCSHSCRNWLPLEGWNHVVKLLCGSLTRLLDSVRAIQAAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLSIETLTCYETLSKTNPSVSSLRSRAHEQRFLKSIAEGIGPEERRQTLLQKMSSF

Predict reactive species
Full Name gem (nuclear organelle) associated protein 4
Calculated Molecular Weight 1058 aa, 120 kDa
Observed Molecular Weight 120-130 kDa
GenBank Accession NumberBC020062
Gene Symbol GEMIN4
Gene ID (NCBI) 50628
RRIDAB_10640891
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP57678
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GEMIN4, also named as P97, is a sub-unit of SMN complex. The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs). It plays an important role in the splicing of cellular pre-mRNAs. The express amount of GEMIN4 is about 8.79 ppm (http://pax-db.org/#!protein/984742). This antibody detects 97-110 kDa GEMIN4.

Protocols

Product Specific Protocols
IP protocol for GEMIN4 antibody 12408-1-APDownload protocol
WB protocol for GEMIN4 antibody 12408-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...