Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells |
| Positive IP detected in | HEK-293 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12408-1-AP targets GEMIN4 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3099 Product name: Recombinant human GEMIN4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 703-1058 aa of BC020062 Sequence: QLLDRFSKYWQLPKEKRCLSLDRKDLAIHILELLCEIVSANAETFSPDVWIKSLSWLHRKLEQLDWTVGLRLKSFFEGHFKCEVPATLFEICKLSEDEWTSQAHPGYGAGTGLLAWMECCCVSSGISERMLSLLVVDVGNPEEVRLFSKGFLVALVQVMPWCSPQEWQRLHQLTRRLLEKQLLHVPYSLEYIQFVPLLNLKPFAQELQLSVLFLRTFQFLCSHSCRNWLPLEGWNHVVKLLCGSLTRLLDSVRAIQAAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLSIETLTCYETLSKTNPSVSSLRSRAHEQRFLKSIAEGIGPEERRQTLLQKMSSF Predict reactive species |
| Full Name | gem (nuclear organelle) associated protein 4 |
| Calculated Molecular Weight | 1058 aa, 120 kDa |
| Observed Molecular Weight | 120-130 kDa |
| GenBank Accession Number | BC020062 |
| Gene Symbol | GEMIN4 |
| Gene ID (NCBI) | 50628 |
| RRID | AB_10640891 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P57678 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GEMIN4, also named as P97, is a sub-unit of SMN complex. The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs). It plays an important role in the splicing of cellular pre-mRNAs. The express amount of GEMIN4 is about 8.79 ppm (http://pax-db.org/#!protein/984742). This antibody detects 97-110 kDa GEMIN4.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for GEMIN4 antibody 12408-1-AP | Download protocol |
| WB protocol for GEMIN4 antibody 12408-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







