Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, HEK-293 cells, mouse thymus tissue, mouse kidney tissue, mouse lung tissue |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IF | See 2 publications below |
Product Information
13754-1-AP targets Histone H3.3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4696 Product name: Recombinant human Histone H3.3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC038989 Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species |
| Full Name | H3 histone, family 3A |
| Calculated Molecular Weight | 136 aa, 15 kDa |
| Observed Molecular Weight | 15-17 kDa |
| GenBank Accession Number | BC038989 |
| Gene Symbol | Histone H3 |
| Gene ID (NCBI) | 3020 |
| RRID | AB_2115140 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P84243 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Histones are the basic nuclear proteins responsible for the nucleosome structure of the chromosomal fiber. Five classes of histone genes have been reported, some of which are expressed only during S phase, while others are replication independent. The latter are referred to as replacement histones and are expressed in quiescent or terminally differentiated cells. [PMID: 8586426] Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. H3F3A is one replacement histone [PMID:16258499].
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Histone H3.3 antibody 13754-1-AP | Download protocol |
| IHC protocol for Histone H3.3 antibody 13754-1-AP | Download protocol |
| IF protocol for Histone H3.3 antibody 13754-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun Protective effects of 4-octyl itaconate against inflammatory response in angiotensin II-induced oxidative stress in human primary retinal pigment epithelium. | ||
Fish Shellfish Immunol Triclocarban evoked neutrophil extracellular trap formation in common carp (Cyprinus carpio L.) by modulating SIRT3-mediated ROS crosstalk with ERK1/2/p38 signaling | ||
Clin Transl Med LncRNA NEAT1 suppresses cellular senescence in hepatocellular carcinoma via KIF11-dependent repression of CDKN2A
| ||
J Hepatol IL-6/STAT3 axis dictates the PNPLA3-mediated susceptibility to non-alcoholic fatty liver disease |















