Tested Applications
| Positive WB detected in | THP-1 cells, A431 cells, U-87 MG cells |
| Positive IHC detected in | human lung cancer tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | LPS treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66737-1-Ig targets IL-1 beta in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rabbit, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26030 Product name: Recombinant human IL-1B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species |
| Full Name | interleukin 1, beta |
| Calculated Molecular Weight | 269 aa, 31 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC008678 |
| Gene Symbol | IL1B |
| Gene ID (NCBI) | 3553 |
| ENSEMBL Gene ID | ENSG00000125538 |
| RRID | AB_2882087 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01584 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
| IHC protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
| WB protocol for IL-1 beta antibody 66737-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
IL-1β Monoclonal Antibody (2A1B4), catalog no. 66737-1-Ig, has accumulated 135 citations. Publications appear in high-impact journals including Nature Communications, Cell Metabolism, Advanced Materials, Oncogene, Biomaterials, Acta Biomaterialia, and Journal of Ethnopharmacology, among others. Research fields span inflammation and pyroptosis, neurodegeneration, cardiovascular disease, liver pathology, oncology, metabolic disorders, autoimmune diseases, wound healing, and traditional Chinese medicine pharmacology.
| Species | Application | Title |
|---|---|---|
Cell Metab Lighting up arginine metabolism reveals its functional diversity in physiology and pathology | ||
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
Nat Commun Metabolomics and proteomics reveal blocking argininosuccinate synthetase 1 alleviates colitis in mice | ||
J Adv Res A cocktail hydrogel promoting the functional interneurons regeneration of human neural progenitor cells for brain injury therapy | ||
J Nanobiotechnology Low-dose celecoxib-loaded PCL fibers reverse intervertebral disc degeneration by up-regulating CHSY3 expression | ||
J Nanobiotechnology Implantation of biomimetic polydopamine nanocomposite scaffold promotes optic nerve regeneration through modulating inhibitory microenvironment |
