Filter:
Product Information
83457-1-RR targets LPAR4 in ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17817 Product name: Recombinant human LPAR4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 311-370 aa of BC069996 Sequence: YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF Predict reactive species |
| Full Name | lysophosphatidic acid receptor 4 |
| Calculated Molecular Weight | 370 aa, 42 kDa |
| GenBank Accession Number | BC069996 |
| Gene Symbol | LPAR4 |
| Gene ID (NCBI) | 2846 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q99677 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
