Tested Applications
| Positive WB detected in | K-562 cells, HepG2 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
14882-1-AP targets NARS in WB, IP, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6656 Product name: Recombinant human NARS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 199-548 aa of BC001687 Sequence: ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP Predict reactive species |
| Full Name | asparaginyl-tRNA synthetase |
| Calculated Molecular Weight | 63 kDa |
| Observed Molecular Weight | 63 kDa |
| GenBank Accession Number | BC001687 |
| Gene Symbol | NARS |
| Gene ID (NCBI) | 4677 |
| RRID | AB_2151040 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43776 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Asparagine-tRNA ligase (NARS) belongs to the class-II aminoacyl-tRNA synthetase family. Catalyzes the attachment of asparagine to tRNA(Asn) in a two-step reaction: asparagine is first activated by ATP to form Asn-AMP and then transferred to the acceptor end of tRNA(Asn) (PubMed: 9421509). In addition to its essential role in protein synthesis, acts as a signaling molecule that induced migration of CCR3-expressing cells. The NARS levels were higher in tumor tissues compared with adjacent normal tissues, and positively associated with LN metastasis. NARS may serve as a potential biomarker for lung adenocarcinoma (ADC) diagnosis/prognosis (PMID: 27161446).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NARS antibody 14882-1-AP | Download protocol |
| IP protocol for NARS antibody 14882-1-AP | Download protocol |
| WB protocol for NARS antibody 14882-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









