Tested Applications
| Positive WB detected in | human placenta tissue, fetal human brain tissue, human plasma, 37°C incubated human placenta tissue, pig brain tissue, HeLa cells, rabbit heart tissue, MDA-MB-231 cells, A549 cells, pig heart tissue |
| Positive IF/ICC detected in | SH-SY5Y cells, human embronic stem cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 15 publications below |
| IF | See 10 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
60067-1-Ig targets Neuropilin 1/CD304 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, pig, rabbit samples.
| Tested Reactivity | human, pig, rabbit |
| Cited Reactivity | human, mouse, rabbit, xenopus |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0931 Product name: Recombinant human NRP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC007737 Sequence: MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN Predict reactive species |
| Full Name | neuropilin 1 |
| Calculated Molecular Weight | 103 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC007737 |
| Gene Symbol | Neuropilin 1 |
| Gene ID (NCBI) | 8829 |
| RRID | AB_2150840 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O14786 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neuropilin-1 (NRP1) is a 130-140 kDa transmembrane glycoprotein expressed by endothelial, dendritic, and regulatory T cells, as well as several other normal cell types and malignant tumor cells. NRP1 was first identified as a semaphorin (SEMA) receptor, involved in axonal guidance in embryonic development. NRP1 was also shown to act as a receptor for vascular endothelial growth factor (VEGF) and a promoter of angiogenesis through its interaction with VEGF-A165 (and other VEGFs) and the receptor tyrosine kinase (RTK) VEGF-R2. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Neuropilin 1/CD304 antibody 60067-1-Ig | Download protocol |
| WB protocol for Neuropilin 1/CD304 antibody 60067-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Elife Receptor-specific interactome as a hub for rapid cue-induced selective translation in axons. | ||
Acta Biomater Semaphorin-3A, Neuropilin-1 and Plexin-A1 in Prosthetic-Particle Induced Bone Loss. | ||
J Pathol Perivascular Neuropilin-1 expression is an independent marker of improved survival in renal cell carcinoma. | ||
Am J Cancer Res CMTM6 promotes cell proliferation and invasion in oral squamous cell carcinoma by interacting with NRP1. | ||
Pharm Res Dual Receptor Targeting Cell Penetrating Peptide Modified Liposome for Glioma and Breast Cancer Postoperative Recurrence Therapy. | ||
Exp Eye Res Expression of axon guidance ligands and their receptors in the cornea and trigeminal ganglia and their recovery after corneal epithelium injury. |





















