Neuropilin 1/CD304 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 60067-1-Ig (same clone as 60067-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60067-1-Ig (same clone as 60067-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit heart using 60067-1-Ig (same clone as 60067-1-PBS)

  rabbit heart tissue were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-231 using 60067-1-Ig (same clone as 60067-1-PBS)

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 60067-1-Ig (same clone as 60067-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 60067-1-Ig (same clone as 60067-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 60067-1-Ig (same clone as 60067-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 60067-1-Ig (same clone as 60067-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 60067-1-Ig (same clone as 60067-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human embronic stem cells using 60067-1-Ig (same clone as 60067-1-PBS)

  Confocal immunofluorescent analysis of human embronic stem cells with 60067-1-Ig at dilution of 1:100. DAPI was used to stain the cell nuclei (blue) at a concentration of 1ug/ml. This photo is the merge of PE and DAPI. (40X). This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 60067-1-Ig (same clone as 60067-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed SH-SY5Y cells using 60067-1-Ig(Neuropilin 1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60067-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50479-1

  Cytometric bead array standard curve of MP50479-1, NRP1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60067-1-PBS. Detection antibody: 60067-2-PBS. Standard:Ag0931. Range: 0.391-100 ng/mL.

• Featured Product
• KD/KO Validated

Neuropilin 1/CD304 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 60067-1-PBS

Clone No.2H3F6

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rabbit

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

Neuropilin 1, NRP1, 2H3F6, BDCA4, CD304

---

Product Information

60067-1-PBS targets Neuropilin 1/CD304 as part of a matched antibody pair:

MP50479-1: 60067-1-PBS capture and 60067-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0931

  Product name: Recombinant human NRP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC007737

  Sequence: MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN

• Full Name: neuropilin 1
• Calculated Molecular Weight: 103 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC007737
• Gene Symbol: Neuropilin 1
• Gene ID (NCBI): 8829
• RRID: AB_2150840
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14786
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Neuropilin-1 (NRP1) is a 130-140 kDa transmembrane glycoprotein expressed by endothelial, dendritic, and regulatory T cells, as well as several other normal cell types and malignant tumor cells. NRP1 was first identified as a semaphorin (SEMA) receptor, involved in axonal guidance in embryonic development. NRP1 was also shown to act as a receptor for vascular endothelial growth factor (VEGF) and a promoter of angiogenesis through its interaction with VEGF-A165 (and other VEGFs) and the receptor tyrosine kinase (RTK) VEGF-R2. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.