• Featured Product
  • KD/KO Validated

Neuropilin 1/CD304 Monoclonal antibody, PBS Only (Capture)

Neuropilin 1/CD304 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 60067-1-PBS
Clone No.2H3F6

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rabbit

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Neuropilin 1, NRP1, 2H3F6, BDCA4, CD304

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60067-1-PBS targets Neuropilin 1/CD304 as part of a matched antibody pair:

MP50479-1: 60067-1-PBS capture and 60067-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0931

Product name: Recombinant human NRP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC007737

Sequence: MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN

Predict reactive species
Full Name neuropilin 1
Calculated Molecular Weight 103 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC007737
Gene Symbol Neuropilin 1
Gene ID (NCBI) 8829
RRIDAB_2150840
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14786
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Neuropilin-1 (NRP1) is a 130-140 kDa transmembrane glycoprotein expressed by endothelial, dendritic, and regulatory T cells, as well as several other normal cell types and malignant tumor cells. NRP1 was first identified as a semaphorin (SEMA) receptor, involved in axonal guidance in embryonic development. NRP1 was also shown to act as a receptor for vascular endothelial growth factor (VEGF) and a promoter of angiogenesis through its interaction with VEGF-A165 (and other VEGFs) and the receptor tyrosine kinase (RTK) VEGF-R2. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.

Loading...
||
New chat Able
正在加载,请稍候...