Tested Applications
| Positive WB detected in | L02 cells, human placenta tissue, MCF-7 cells, PC-3 cells | 
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below | 
| WB | See 7 publications below | 
| IHC | See 2 publications below | 
Product Information
14661-1-AP targets PHLDA2 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human, goat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag6331 Product name: Recombinant human PHLDA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC005034 Sequence: MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP Predict reactive species | 
                                    
| Full Name | pleckstrin homology-like domain, family A, member 2 | 
| Calculated Molecular Weight | 17 kDa | 
| Observed Molecular Weight | 20-25 kDa | 
| GenBank Accession Number | BC005034 | 
| Gene Symbol | PHLDA2 | 
| Gene ID (NCBI) | 7262 | 
| RRID | AB_2163294 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q53GA4 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PHLDA2 antibody 14661-1-AP | Download protocol | 
| WB protocol for PHLDA2 antibody 14661-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Nat Commun Qualitative differences in disease-associated MEK mutants reveal molecular signatures and aberrant signaling-crosstalk in cancer. | ||
Aging (Albany NY) PHLDA2 regulates EMT and autophagy in colorectal cancer via the PI3K/AKT signaling pathway.
  | ||
Pathol Res Pract FOSL1 transcriptionally regulates PHLDA2 to promote 5-FU resistance in colon cancer cells
  | ||
Cell Metab PHLDA2-mediated phosphatidic acid peroxidation triggers a distinct ferroptotic response during tumor suppression | 











