Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human gliomas tissue, mouse brain tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11947-1-AP targets RAB5A in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2549 Product name: Recombinant human RAB5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC001267 Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Predict reactive species |
| Full Name | RAB5A, member RAS oncogene family |
| Calculated Molecular Weight | 215 aa, 24 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC001267 |
| Gene Symbol | RAB5A |
| Gene ID (NCBI) | 5868 |
| RRID | AB_2269388 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20339 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAB5A antibody 11947-1-AP | Download protocol |
| IHC protocol for RAB5A antibody 11947-1-AP | Download protocol |
| IP protocol for RAB5A antibody 11947-1-AP | Download protocol |
| WB protocol for RAB5A antibody 11947-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
RAB5A Rabbit mAb (Cat# 11947-1-AP) has 57 citations across journals including Cell Metabolism, Immunity, Nature Genetics, Nature Communications, Autophagy, ACS Nano, Cell Reports, eLife, FASEB Journal, and Development. Associated research fields span lipid metabolism, endosomal trafficking, autophagy/mitophagy, cancer biology, neurodegeneration (Parkinson's, Alzheimer's), viral infections, diabetes, cardiovascular disease, and ferroptosis.
| Species | Application | Title |
|---|---|---|
Cell Metab Sensing steroid hormone 17α-hydroxypregnenolone by GPR56 enables protection from ferroptosis-induced liver injury | ||
Cell Metab Hepatic lipid remodeling in cold exposure uncovers direct regulation of bis(monoacylglycero)phosphate lipids by phospholipase A2 group XV | ||
Immunity trans-Endothelial neutrophil migration activates bactericidal function via Piezo1 mechanosensing | ||
Immunity Targeting intracellular oncoproteins with dimeric IgA promotes expulsion from the cytoplasm and immune-mediated control of epithelial cancers | ||
Autophagy RAB7 activity is required for the regulation of mitophagy in oocyte meiosis and oocyte quality control during ovarian aging. |
Reviews
What customers say
Users generally rate this antibody favorably, especially for Western blot. Three reviewers reported strong, clear signals at dilutions ranging from 1:1000 to 1:4000 in cell lysates and tissue samples. One user noted the WB signal was slightly weaker than expected but still functional. For immunofluorescence, results were mixed—one reviewer observed good signal but strong background at 1:500 in primary neurons, while another confirmed good IF performance in HEK cells. Overall, the antibody is considered reliable for WB with a high titer, though IF users may need to optimize conditions to reduce background.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Baptiste (Verified Customer) (06-08-2026) | Good signal but strong background.
|
Sophy (Verified Customer) (02-27-2023) | The antibody was used at 1:1000 for western blot. The signal showed up but not as strong as expected. But since this was the only antibody purchased for Rab5A, I had no comparison to antibodies to other vendors.
|
Xin (Verified Customer) (01-24-2022) | Very good antibody in WB (25 kD) with a high titer
|
Tom (Verified Customer) (11-13-2020) | HEK293T cell extracts (10ug/lane). Primary antibody (1:2000) in block (5% BSA) incubated at 4 degrees overnight. Goat anti-rabbit HRP secondary antibody (1:10,000) incubated for 1 hour at RT.
 |
Aamir (Verified Customer) (01-19-2020) | Used in HEK cells. Good signal for WB and IF
|
