Filter: AllWBIPIHC

WB analysis using 11947-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11947-1-AP (RAB5A antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.
WB analysis using 11947-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11947-1-AP (RAB5A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
WB analysis of human brain using 11947-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 11947-1-AP (RAB5A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
IP experiment of mouse brain using 11947-1-AP
IP result of anti-RAB5A (IP:11947-1-AP, 4ug; Detection:11947-1-AP 1:10000) with mouse brain tissue lysate 1680 ug.
IHC staining of human gliomas using 11947-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11947-1-AP (RAB5A Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human gliomas using 11947-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11947-1-AP (RAB5A Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 11947-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11947-1-AP (RAB5A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human pancreas using 11947-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 11947-1-AP (RAB5A Antibody) at dilution of 1:200 (under 10x lens).
IHC staining of human pancreas using 11947-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 11947-1-AP (RAB5A Antibody) at dilution of 1:200 (under 40x lens).

Featured Product
KD/KO Validated

RAB5A Polyclonal antibody

Name: RAB5A Polyclonal antibody
Brand: Proteintech
SKU: 11947-1-AP
Rating: 4.50 (4 reviews)

RAB5A Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11947-1-AP

Publications(45)

Reviews (4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

RAB5, EC:3.6.5.2, Ras related protein Rab 5A, Ras-related protein Rab-5A

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (45)
Protocols
Reviews (4)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse brain tissue, HeLa cells, human brain tissue, rat brain tissue
Positive IP detected in	mouse brain tissue
Positive IHC detected in	human gliomas tissue, mouse brain tissue, human pancreas tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 8 publications below
WB	See 31 publications below
IHC	See 7 publications below
IF	See 20 publications below
IP	See 2 publications below

Product Information

11947-1-AP targets RAB5A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, pig, monkey, zebrafish
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2549 Product name: Recombinant human RAB5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC001267 Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Predict reactive species
Full Name	RAB5A, member RAS oncogene family
Calculated Molecular Weight	215 aa, 24 kDa
Observed Molecular Weight	24 kDa
GenBank Accession Number	BC001267
Gene Symbol	RAB5A
Gene ID (NCBI)	5868
RRID	AB_2269388
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P20339
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for RAB5A antibody 11947-1-AP	Download protocol
IP protocol for RAB5A antibody 11947-1-AP	Download protocol
WB protocol for RAB5A antibody 11947-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	IF	Nat Genet Identification of TMEM230 mutations in familial Parkinson's disease. Authors - Han-Xiang Deng View Article
human	WB,IP	Autophagy Live imaging of intra-lysosome pH in cell lines and primary neuronal culture using a novel genetically encoded biosensor. Authors - Amy H Ponsford View Article
mouse	WB	Autophagy RAB7 activity is required for the regulation of mitophagy in oocyte meiosis and oocyte quality control during ovarian aging. Authors - Xin Jin View Article
mouse	WB,IHC	Diabetes Atorvastatin Targets the Islet Mevalonate Pathway to Dysregulate mTOR Signaling and Reduce β-Cell Functional Mass. Authors - Linyan Shen KD Validated View Article
rat	WB,IF	Sci Signal Semaphorin 3A activates the guanosine triphosphatase Rab5 to promote growth cone collapse and organize callosal axon projections. Authors - Kong-Yan Wu View Article
human	WB,IP,IF	Elife Capping protein regulates endosomal trafficking by controlling F-actin density around endocytic vesicles and recruiting RAB5 effectors. Authors - Dawei Wang View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH Sophy (Verified Customer) (02-27-2023)	The antibody was used at 1:1000 for western blot. The signal showed up but not as strong as expected. But since this was the only antibody purchased for Rab5A, I had no comparison to antibodies to other vendors. Applications: Western Blot Cell Tissue Type: NSCLC cells
FH Xin (Verified Customer) (01-24-2022)	Very good antibody in WB (25 kD) with a high titer Applications: Western Blot Primary Antibody Dilution: 1:4000 Cell Tissue Type: mouse brain lysate
FH Tom (Verified Customer) (11-13-2020)	HEK293T cell extracts (10ug/lane). Primary antibody (1:2000) in block (5% BSA) incubated at 4 degrees overnight. Goat anti-rabbit HRP secondary antibody (1:10,000) incubated for 1 hour at RT. Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: HEK293T RAB5A Antibody Western Blot validation (1:2000 dilution) in HEK293T (Cat no:11947-1-AP)
FH Aamir (Verified Customer) (01-19-2020)	Used in HEK cells. Good signal for WB and IF Applications: Western Blot, Immunofluorescence, Cell Tissue Type: HEKs