Use Able AI chat for product recommendations

RBPJ Polyclonal antibody

RBPJ Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

CBF 1, CBF1, CBF-1, csl, IGKJRB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RBPJ in ?

Tested Applications

Positive WB detected inHepG2 cells, MCF-7 cells, NIH/3T3 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30044-1-AP targets RBPJ in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32552

Product name: Recombinant human RBPJ protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 380-486 aa of BC064976

Sequence: MYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS

Predict reactive species
Full Name recombination signal binding protein for immunoglobulin kappa J region
Calculated Molecular Weight 56 kDa
Observed Molecular Weight~60 kDa
GenBank Accession NumberBC064976
Gene Symbol RBPJ
Gene ID (NCBI) 3516
RRIDAB_3086217
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ06330
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBPJ, also named as IGKJRB, IGKJRB1, RBPJK, RBPSUH, NY-REN-30, CBF-1 and CSL, belongs to the Su(H) family. It is a transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. RBPJ acts as a transcriptional repressor when it is not associated with Notch proteins. It is specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. RBPJ binds to the Runx3 promoter in the atrioventricular canal in vivo, and inhibition of Notch reduces RUNX3 expression in the cardiac cushion of embryonic hearts.

Protocols

Product Specific Protocols
IHC protocol for RBPJ antibody 30044-1-APDownload protocol
IP protocol for RBPJ antibody 30044-1-APDownload protocol
WB protocol for RBPJ antibody 30044-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RBPJ Polyclonal antibody (Cat# 30044-1-AP) has 7 citations published in journals including Cancer Cell, Nature Communications, Cell Signaling, Cell Communications and Signaling, Archives of Pharmacal Research, EMBO Molecular Medicine, and World Journal of Diabetes. The research fields span esophageal carcinogenesis, CADASIL pathogenesis, hepatocellular carcinoma, triple-negative breast cancer, hepatic glycogenesis, RBPJ ubiquitination/stemness regulation, and colitis-related monocyte-macrophage transition.

SpeciesApplicationTitle
humanIP

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
mouse,humanWB,IP

Cell Commun Signal

Reduced SUMOylation impairs NOTCH3 signaling and cell survival in the pathogenesis of CADASIL.

Authors - Lijun Long
humanWB,IP

Arch Pharm Res

Inhibition of RBPJ transcription complex promotes IL-17 and IFN-γ secretion by CD4⁺ T cells in hepatocellular carcinoma.

Authors - Yuxin Yao
humanIP

EMBO Mol Med

Reciprocal inhibition of NOTCH and SOX2 shapes tumor cell plasticity and therapeutic escape in triple-negative breast cancer

Authors - Morgane Fournier
mouseWB

World J Diabetes

Exosomal transfer of miR-375-3p from pancreatic β cells to hepatocytes impairs hepatic glycogenesis via Rbpj repression.

Authors - Fang-Zhi Xu

Cell Signal

TRIM41 stabilizes RBPJ through K63 linked ubiquitination and promotes stemness of hepatocellular carcinoma cells.

Authors - Hao Wu
Loading...
||
New chat

Able™

正在加载,请稍候...