Tested Applications
| Positive WB detected in | HepG2 cells, MCF-7 cells, NIH/3T3 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30044-1-AP targets RBPJ in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32552 Product name: Recombinant human RBPJ protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 380-486 aa of BC064976 Sequence: MYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS Predict reactive species |
| Full Name | recombination signal binding protein for immunoglobulin kappa J region |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | ~60 kDa |
| GenBank Accession Number | BC064976 |
| Gene Symbol | RBPJ |
| Gene ID (NCBI) | 3516 |
| RRID | AB_3086217 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q06330 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RBPJ, also named as IGKJRB, IGKJRB1, RBPJK, RBPSUH, NY-REN-30, CBF-1 and CSL, belongs to the Su(H) family. It is a transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. RBPJ acts as a transcriptional repressor when it is not associated with Notch proteins. It is specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. RBPJ binds to the Runx3 promoter in the atrioventricular canal in vivo, and inhibition of Notch reduces RUNX3 expression in the cardiac cushion of embryonic hearts.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RBPJ antibody 30044-1-AP | Download protocol |
| IP protocol for RBPJ antibody 30044-1-AP | Download protocol |
| WB protocol for RBPJ antibody 30044-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RBPJ Polyclonal antibody (Cat# 30044-1-AP) has 7 citations published in journals including Cancer Cell, Nature Communications, Cell Signaling, Cell Communications and Signaling, Archives of Pharmacal Research, EMBO Molecular Medicine, and World Journal of Diabetes. The research fields span esophageal carcinogenesis, CADASIL pathogenesis, hepatocellular carcinoma, triple-negative breast cancer, hepatic glycogenesis, RBPJ ubiquitination/stemness regulation, and colitis-related monocyte-macrophage transition.
| Species | Application | Title |
|---|---|---|
Cell Commun Signal Reduced SUMOylation impairs NOTCH3 signaling and cell survival in the pathogenesis of CADASIL. | ||
Arch Pharm Res Inhibition of RBPJ transcription complex promotes IL-17 and IFN-γ secretion by CD4⁺ T cells in hepatocellular carcinoma. | ||
EMBO Mol Med Reciprocal inhibition of NOTCH and SOX2 shapes tumor cell plasticity and therapeutic escape in triple-negative breast cancer | ||
World J Diabetes Exosomal transfer of miR-375-3p from pancreatic β cells to hepatocytes impairs hepatic glycogenesis via Rbpj repression. | ||
Cell Signal TRIM41 stabilizes RBPJ through K63 linked ubiquitination and promotes stemness of hepatocellular carcinoma cells. |











