Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis using 14643-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 14643-1-AP (REEP5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 14643-1-AP
WB result of REEP5 antibody (14643-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-REEP5 transfected HeLa cells.
IP experiment of HeLa using 14643-1-AP
IP result of anti-REEP5 (IP:14643-1-AP, 4ug; Detection:14643-1-AP 1:10000) with HeLa cells lysate 1280 ug.
IHC staining of human colon cancer using 14643-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14643-1-AP (REEP5 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 14643-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14643-1-AP (REEP5 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of A549 using 14643-1-AP
Immunofluorescent analysis of (4% PFA) fixed A549 cells using REEP5 antibody (14643-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). F-actin is stained using CL555-phalloidin (red) and DNA is stained by DAPI (blue).
FC experiment of HeLa using 14643-1-AP
1x10^6 HeLa cells were intracellularly stained with 0.25 ug REEP5 Polyclonal antibody (14643-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Featured Product
KD/KO Validated

REEP5 Polyclonal antibody

REEP5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 14643-1-AP

Publications(54)

Reviews (5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

C5orf18, DP1, Polyposis locus protein 1, Protein TB2, Receptor expression-enhancing protein 5

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (54)
Protocols
Reviews (5)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, mouse heart tissue, rat heart tissue
Positive IP detected in	HeLa cells
Positive IHC detected in	human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	A549 cells
Positive FC (Intra) detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:300-1:1200
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 5 publications below
WB	See 38 publications below
IHC	See 1 publications below
IF	See 24 publications below
IP	See 4 publications below

Product Information

14643-1-AP targets REEP5 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, monkey, xenopus
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag6229 Product name: Recombinant human REEP5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-189 aa of BC065926 Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST Predict reactive species
Full Name	receptor accessory protein 5
Calculated Molecular Weight	21 kDa
Observed Molecular Weight	18-21 kDa
GenBank Accession Number	BC065926
Gene Symbol	REEP5
Gene ID (NCBI)	7905
RRID	AB_2178440
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q00765
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

REEP5 (receptor expression-enhancing protein 5), also named as C5orf18, DP1 or TB2, is a membrane protein belonging to DP1/Yop1p protein family. All REEP proteins contain a conserved TB2/DP1, HVA22 domain which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis, and may have the function to influence functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2) which are involved in modulating the structure of ER network (PMID: 19665976).

Protocols

Product Specific Protocols
IF protocol for REEP5 antibody 14643-1-AP	Download protocol
IHC protocol for REEP5 antibody 14643-1-AP	Download protocol
IP protocol for REEP5 antibody 14643-1-AP	Download protocol
WB protocol for REEP5 antibody 14643-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Nature ER proteins decipher the tubulin code to regulate organelle distribution Authors - Pengli Zheng View Article
human	WB	Cell A Genome-wide ER-phagy Screen Highlights Key Roles of Mitochondrial Metabolism and ER-Resident UFMylation. Authors - Jin Rui Liang KO Validated View Article
mouse	WB	Cell Metab Receptor-Mediated ER Export of Lipoproteins Controls Lipid Homeostasis in Mice and Humans. Authors - Xiao Wang View Article
human	WB	Nat Cell Biol Combinatorial selective ER-phagy remodels the ER during neurogenesis Authors - Melissa J Hoyer View Article
human	WB	Nat Struct Mol Biol Aurora kinase A-mediated phosphorylation triggers structural alteration of Rab1A to enhance ER complexity during mitosis Authors - Wei Zhang View Article
human	WB	Nat Commun AMFR-mediated Flavivirus NS2A ubiquitination subverts ER-phagy to augment viral pathogenicity Authors - Linliang Zhang View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH Andrea (Verified Customer) (05-10-2022)	Sharp and strong signal at 21 kDa with clear background. Applications: Western Blot Primary Antibody Dilution: 1:250 Cell Tissue Type: HeLa cell line REEP5 Antibody Western Blot validation (1:250 dilution) in HeLa cell line (Cat no:14643-1-AP)
FH Christine (Verified Customer) (11-10-2021)	Very good detection of endogenous REEP5 protein in human HEK293T and HeLa cell lines. Band at about 20 kDa (expected size for REEP5) Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: Cell culture of HeLa and HEK293T
FH Wei (Verified Customer) (09-22-2020)	The antibody gets sharp, single band on western blot. Applications: Western Blot Cell Tissue Type: Mouse heart
FH WEI (Verified Customer) (06-29-2020)	The staining pattern is consistent with cardiomyocytes like ER localization. Applications: Immunofluorescence, Primary Antibody Dilution: 1:3000 Cell Tissue Type: Mouse Heart
FH H (Verified Customer) (04-05-2020)	The antibody is very sensitive, such that 1 hour incubation using 1:3000 dilution worked perfectly. Applications: Western Blot Primary Antibody Dilution: 1:3000 Cell Tissue Type: HEK293T and HCT116 REEP5 Antibody Western Blot validation (1:3000 dilution) in HEK293T and HCT116 (Cat no:14643-1-AP)