• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated REEP5 Polyclonal antibody

REEP5 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-14643

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

C5orf18, DP1, Polyposis locus protein 1, Protein TB2, Receptor expression-enhancing protein 5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells, A549 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14643 targets REEP5 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6229

Product name: Recombinant human REEP5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-189 aa of BC065926

Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Predict reactive species
Full Name receptor accessory protein 5
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 18-21 kDa
GenBank Accession NumberBC065926
Gene Symbol REEP5
Gene ID (NCBI) 7905
RRIDAB_2919098
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen Affinity Purified
UNIPROT IDQ00765
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

REEP5 (receptor expression-enhancing protein 5), also named C5orf18, DP1, or TB2, is a membrane protein belonging to the DP1/Yop1p protein family. All REEP proteins contain a conserved TB2/DP1, HVA22 domain which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis and may have the function of influencing functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2) which are involved in modulating the structure of the ER network (PMID: 19665976).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 REEP5 antibody CL488-14643Download protocol
IF protocol for CL Plus 488 REEP5 antibody CL488-14643Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...