CoraLite® Plus 488-conjugated REEP5 Polyclonal antibody

• 

  IF Staining of A549 using CL488-14643

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using CoraLite® Plus 488 REEP5 antibody (CL488-14643) at dilution of 1:200, CL594-Phalloidin (red).

• 

  IF Staining of HeLa using CL488-14643

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 REEP5 antibody (CL488-14643) at dilution of 1:200, CL594-Phalloidin (red).

• 

  FC experiment of HeLa using CL488-14643

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human REEP5 (CL488-14643) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

REEP5 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-14643

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

TB2, Receptor expression-enhancing protein 5, Protein TB2, Polyposis locus protein 1, DP1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells, A549 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14643 targets REEP5 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6229

  Product name: Recombinant human REEP5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-189 aa of BC065926

  Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

• Full Name: receptor accessory protein 5
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 18-21 kDa
• GenBank Accession Number: BC065926
• Gene Symbol: REEP5
• Gene ID (NCBI): 7905
• RRID: AB_2919098
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen Affinity Purified
• UNIPROT ID: Q00765
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

REEP5 (receptor expression-enhancing protein 5), also named C5orf18, DP1, or TB2, is a membrane protein belonging to the DP1/Yop1p protein family. All REEP proteins contain a conserved TB2/DP1, HVA22 domain which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis and may have the function of influencing functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2) which are involved in modulating the structure of the ER network (PMID: 19665976).