Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MST1 Polyclonal antibody

MST1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

MST2, STK4, STK4/MST1, EC:2.7.11.1, KRS2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MST1 in ?

Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, rat liver tissue, Jurkat cells, Ramos cells, C2C12 cells, mouse spleen tissue, rat spleen tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22245-1-AP targets MST1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17738

Product name: Recombinant human STK4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 383-451 aa of BC093768

Sequence: RRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLAL

Predict reactive species
Full Name serine/threonine kinase 4
Calculated Molecular Weight 487 aa, 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC093768
Gene Symbol MST1
Gene ID (NCBI) 6789
RRIDAB_11182388
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13043
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mammalian STE20-like serine-threonine kinase MST1, encoded by the STK4 gene, is a multifunctional protein. MST1 and its closest paralogs MST2 (encoded by the STK3 gene), MST3, and MST4 are members of the Class II Germinal Center Family of Protein Kinases . STK3/4 and LATS1/2 (large tumor suppressor 1 and 2) are core kinase components of the Hippo tumor suppressor pathway in mammalians . In the conventional Hippo pathway, the STK3/4 and LATS1/2 signaling cascade phosphorylates and inactivates the transcriptional coactivator YAP1 (yes associated protein 1) and its close paralog WWTR1]. YAP1 and WWTR1 do not have DNA binding domains and they exert their biological outputs, such as cell proliferation and survival, by interacting with the TEAD1-4 transcription factors. Lines of evidence have indicated that dysregulation or loss of STK4/Hippo signaling is linked to developmental disorders and carcinogenesis with poor prognosis. STK4 is a stress-induced kinase and it can be activated in response to cell-death inducers. Autophosphorylation of STK4 at Thr183 (Thr180 in STK3) in the activation loop is a key activation mechanism for STK4/3 because phosphorylation of Thr183/180 causes the cleavage of STK4 by caspases under apoptotic conditions. The caspase-cleavage results in a more active STK4 protein (STK4-N, an amino-terminally truncated STK4), which localizes into the nucleus and induces apoptosis through histone modifications and chromatin condensations.

Protocols

Product Specific Protocols
IF protocol for MST1 antibody 22245-1-APDownload protocol
IHC protocol for MST1 antibody 22245-1-APDownload protocol
IP protocol for MST1 antibody 22245-1-APDownload protocol
WB protocol for MST1 antibody 22245-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The MST1 antibody (Cat# 22245-1-AP) has accumulated 65 citations in journals including Cell, Nature Communications, Oncogene, Autophagy, Science Advances, Advanced Science, Cell Death & Differentiation, Cell Death & Disease, FASEB Journal, and Journal of Immunotherapy of Cancer. Research fields span the Hippo signaling pathway, hepatocellular carcinoma, liver fibrosis, autophagy, cancer progression (lung, colorectal, gastric, breast, bladder), cardiac hypertrophy, bone degeneration, neuroprotection, ophthalmology, reproductive biology, diabetes, and immune regulation.

SpeciesApplicationTitle
mouseWB,IF

Cell

Glycogen accumulation and phase separation drives liver tumor initiation.

Authors - Qingxu Liu

Bioact Mater

Mesenchymal stromal/stem cell spheroid-derived extracellular vesicles advance the therapeutic efficacy of 3D-printed vascularized artificial liver lobules in liver failure treatment

Authors - Jiabin Zhang
humanIF

Autophagy

Phase separation of OPTN initiates mitophagy to orchestrate craniofacial bone mineralization.

Authors - Haojie Liu
human, mouseWB

Autophagy

Mechanical stress-mediated ferritinophagy aggravates cartilage endplate degeneration via a PIEZO1-NCOA4-ZBP1 axis.

Authors - Wenchao Wang
mouseWB

Nat Commun

KK-LC-1 as a therapeutic target to eliminate ALDH+ stem cells in triple negative breast cancer

Authors - Jiawen Bu
humanWB

Nat Commun

Fusobacterium nucleatum reduces METTL3-mediated m6A modification and contributes to colorectal cancer metastasis.

Authors - Shujie Chen

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One user (Pierre D.) reviewed this antibody for Western Blot on T cells, rating it 4 out of 5 stars with the comment "Very Good" (lot 00075987, September 2025). Overall, the single review reflects a positive experience with the product performing well for WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Pierre (Verified Customer) (09-26-2025)

Very Good

  • Applications: Western Blot
  • Cell Tissue Type: T cells
Loading...
||
New chat

Able™

正在加载,请稍候...