Tested Applications
| Positive WB detected in | L02 cells, mouse liver tissue, U-937 cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10911-2-AP targets SULT1A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1344 Product name: Recombinant human SULT1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC000923 Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Predict reactive species |
| Full Name | sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC000923 |
| Gene Symbol | SULT1A1 |
| Gene ID (NCBI) | 6817 |
| RRID | AB_2197593 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50225 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SULT1A1, also named as ST1A1, P-PST 1, ST1A3, Ts-PST, P-PST 1, STP and STP1, belongs to the sulfotransferase 1 family. It catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. SULT1A1 is also responsible for the sulfation and activation of minoxidil. It mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SULT1A1 antibody 10911-2-AP | Download protocol |
| IF protocol for SULT1A1 antibody 10911-2-AP | Download protocol |
| IHC protocol for SULT1A1 antibody 10911-2-AP | Download protocol |
| IP protocol for SULT1A1 antibody 10911-2-AP | Download protocol |
| WB protocol for SULT1A1 antibody 10911-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SULT1A1 Polyclonal antibody (Cat# 10911-2-AP) has 11 citations published in journals including Biochemical Pharmacology, FEBS Journal, Journal of Gastroenterology, Oxidative Medicine and Cellular Longevity, Drug Metabolism and Disposition, Journal of Cancer, Frontiers in Oncology, Journal of Alzheimer's Disease, PLoS One, Cancer Chemotherapy and Pharmacology, and bioRxiv. Research fields span resveratrol metabolism, glioblastoma, thyroid cancer, Barrett's esophagus, osteosarcoma, cognitive function, drug metabolism, and oxidative stress.
| Species | Application | Title |
|---|---|---|
Biochem Pharmacol Identification of metabolic pattern and bioactive form of resveratrol in human medulloblastoma cells. | ||
J Gastroenterol Differential gene expression in normal esophagus and Barrett's esophagus. | ||
Oxid Med Cell Longev Correlation of Reactive Oxygen Species Levels with Resveratrol Sensitivities of Anaplastic Thyroid Cancer Cells. | ||
FEBS J Distinct sulfonation activities in resveratrol-sensitive and resveratrol-insensitive human glioblastoma cells. | ||
Drug Metab Dispos Sulfotransferase 4A1 (SULT4A1) increases its expression in mouse neurons as they mature. | ||
J Cancer Increased Reactive Oxygen Species and Distinct Oxidative Damage in Resveratrol-suppressed Glioblastoma Cells. |













