• Featured Product
  • KD/KO Validated

TFAM Polyclonal antibody

TFAM Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 22586-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA

MtTF1, mtTFA, TCF6, TCF-6, Transcription factor 6-like 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, MCF-7 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22586-1-AP targets TFAM in WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, chicken, zebrafish, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18299

Product name: Recombinant human TFAM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC126366

Sequence: MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

Predict reactive species
Full Name transcription factor A, mitochondrial
Calculated Molecular Weight 246 aa, 29 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC126366
Gene Symbol TFAM
Gene ID (NCBI) 7019
RRIDAB_11182588
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ00059
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TFAM, also named as TCF6L2, MtTF1, TCF6, TCF6L1, TCF6L3 and mtTFA, is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. It is involved in mitochondrial transcription regulation. TFAM is required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It activates transcription by binding immediately upstream of transcriptional start sites. TFAM is able to unwind and bend DNA.

Protocols

Product Specific Protocols
IF protocol for TFAM antibody 22586-1-APDownload protocol
IHC protocol for TFAM antibody 22586-1-APDownload protocol
IP protocol for TFAM antibody 22586-1-APDownload protocol
WB protocol for TFAM antibody 22586-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Nature

A plant-derived natural photosynthetic system for improving cell anabolism

Authors - Pengfei Chen
humanWB

Cell Res

Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression

Authors - Shiqiao Qiu
IHC

Adv Mater

Neonatal Tissue-derived Extracellular Vesicle Therapy (NEXT): A Potent Strategy for Precision Regenerative Medicine

Authors - Peng Lou
WB,IHC

Circulation

Extracellular Tuning of Mitochondrial Respiration Leads to Aortic Aneurysm.

Authors - Jorge Oller
IHC

Cell Metab

Mitochondrial Damage and Activation of the STING Pathway Lead to Renal Inflammation and Fibrosis.

Authors - Ki Wung Chung
humanWB

Nat Cell Biol

Mitochondrial RNA granules are fluid condensates positioned by membrane dynamics.

Authors - Timo Rey

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Dhanwini (Verified Customer) (09-24-2025)

Good

  • Applications: Western Blot
FH

Robert (Verified Customer) (09-24-2025)

Works as intended. Used for CE-SDS.

  • Applications: Other
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: HCEC
FH

Sneha (Verified Customer) (09-24-2025)

GOOD

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: ARPE-19
FH

Emilie (Verified Customer) (09-24-2025)

Produced accurate detection at the expected molecular size range.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Fibroblasts
FH

Michael (Verified Customer) (09-23-2025)

Works great!!

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Corneal cells
FH

Henry (Verified Customer) (09-23-2025)

GOOD RESULTS

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: MIOM1 PBMCS
FH

Sebastian (Verified Customer) (10-25-2023)

Good detection signals for TFAM in western blot of liver from old and young mice, some unspecific bands were slightly visible

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: liver
FH

Tanusree (Verified Customer) (12-18-2019)

Product worked well in WB at 1:500 dilution.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
Loading...
||
New chat Able
正在加载,请稍候...