Tested Applications
| Positive WB detected in | HEK-293 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human kidney tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
| RIP | See 2 publications below |
Product Information
22229-1-AP targets TIMM50 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17574 Product name: Recombinant human TIMM50 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 190-456 aa of BC121147 Sequence: GNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 456 aa, 50 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC121147 |
| Gene Symbol | TIMM50 |
| Gene ID (NCBI) | 92609 |
| RRID | AB_2879039 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q3ZCQ8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMM50 antibody 22229-1-AP | Download protocol |
| IHC protocol for TIMM50 antibody 22229-1-AP | Download protocol |
| IP protocol for TIMM50 antibody 22229-1-AP | Download protocol |
| WB protocol for TIMM50 antibody 22229-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EMBO J Poldip2 promotes mtDNA elimination during Drosophila spermatogenesis to ensure maternal inheritance | ||
Cell Rep TIM23 facilitates PINK1 activation by safeguarding against OMA1-mediated degradation in damaged mitochondria | ||
Elife Genome-wide CRISPRi screening identifies OCIAD1 as a prohibitin client and regulatory determinant of mitochondrial Complex III assembly in human cells. | ||
Front Cell Dev Biol The Novel Non-coding Transcriptional Regulator Gm18840 Drives Cardiomyocyte Apoptosis in Myocardial Infarction Post Ischemia/Reperfusion. | ||
Front Cell Dev Biol Applying Sodium Carbonate Extraction Mass Spectrometry to Investigate Defects in the Mitochondrial Respiratory Chain. |













