Published Applications
| WB | See 2 publications below |
Product Information
60039-1-Ig targets Beta Tubulin in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgM |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0117 Product name: Recombinant human Tubulin-beta protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-259 aa of BC000748 Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP Predict reactive species |
| Full Name | tubulin, beta 3 |
| Calculated Molecular Weight | 450 aa, 50 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC000748 |
| Gene Symbol | TUBB3 |
| Gene ID (NCBI) | 10381 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Thiophilic affinity chromatograph |
| UNIPROT ID | Q13509 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.
Publications
| Species | Application | Title |
|---|---|---|
J Med Chem Novel Indoleamine-2,3-Dioxygenase-Targeted Pt(IV) Prodrugs Regulate the Tumor Immune Microenvironment to Achieve Chemoimmunotherapy In Vitro and In Vivo | ||
Transbound Emerg Dis Recombinant PRV Expressing GP3 and GP5 of PRRSV Provides Effective Protection Against Coinfection With PRV and PRRSV |

