Tested Applications
| Positive WB detected in | SH-SY5Y cells, Jurkat cells, Raji cells, mouse brain tissue, rat brain tissue, NIH/3T3 cells |
| Positive IHC detected in | human skin cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14881-1-AP targets YWHAZ in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6654 Product name: Recombinant human YWHAZ protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-245 aa of BC003623 Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN Predict reactive species |
| Full Name | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 28-30 kDa |
| GenBank Accession Number | BC003623 |
| Gene Symbol | YWHAZ |
| Gene ID (NCBI) | 7534 |
| RRID | AB_2218248 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63104 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YWHAZ (also known as 14-3-3 zeta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised against the full-length YWHAZ.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for YWHAZ antibody 14881-1-AP | Download protocol |
| WB protocol for YWHAZ antibody 14881-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-YWHAZ (14-3-3η) antibody (Cat# 14881-1-AP) has accumulated 32 citations in journals including Molecular Cell, Oncogene, EMBO Journal, Cell Reports, Haematologica, Journal of Translational Medicine, Cell Death & Disease, and Scientific Reports. Research fields span oncology (liver, breast, gastric, colorectal, lung, glioblastoma), immunology, metabolism, neuroscience, cardiology, virology, and diabetes, with applications primarily in WB, IHC, CoIP, and IF.
| Species | Application | Title |
|---|---|---|
Mol Cell Histone phosphorylation integrates the hepatic glucagon-PKA-CREB gluconeogenesis program in response to fasting | ||
J Nanobiotechnology Human adipose-derived mesenchymal stem cell-derived exosomes induce epithelial remodeling and anti-scar healing revealed by single-cell RNA sequencing | ||
J Biomed Sci Targeting enolase 1 reverses bortezomib resistance in multiple myeloma through YWHAZ/Parkin axis | ||
Cell Death Dis TRIP13 promotes tumor growth and is associated with poor prognosis in colorectal cancer.
| ||
Int J Biol Sci YY1-modulated long non-coding RNA SNHG12 promotes gastric cancer metastasis by activating the miR-218-5p/YWHAZ axis. |
Reviews
What customers say
One reviewer used this antibody at a 1:1000 dilution with 11 µg input protein on MIAPACA2 and PANC1 cell lines for Western Blot. They reported obtaining one clean, strong band at the expected molecular weight, and gave the product a 5-star rating.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Erik (Verified Customer) (08-26-2021) | We used the antibody at 1:1000 dilution with 11ug input protein, and it produced one clean and strong band at the expected height for the protein
 |
