Tested Applications
| Positive WB detected in | human peripheral blood platelets |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 6 publications below |
| IF | See 1 publications below |
Product Information
12000-1-AP targets RANTES in WB, IHC, IF, Neutralization, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2617 Product name: Recombinant human CCL5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC008600 Sequence: MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 5 |
| Calculated Molecular Weight | 91 aa, 10 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC008600 |
| Gene Symbol | CCL5/RANTES |
| Gene ID (NCBI) | 6352 |
| RRID | AB_2877815 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13501 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RANTES (CCL5) belongs to the CC chemokine family and induces leukocyte migration by binding to specific receptors in the G protein-coupled receptor family. RANTES (CCL5) has been shown in vitro to mediate eosinophil, lymphocyte, neutrophil, and monocyte chemotaxis, and it initiates several other proinflammatory events, such as integrin activation, lipid mediator biosynthesis, and degranulation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RANTES antibody 12000-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Brain Behav Immun Egln3 expression in microglia enhances the neuroinflammatory responses in Alzheimer's disease | ||
Phytomedicine Integration of transcriptomics and metabolomics reveals the mechanism of Glycyrrhizae Radix Et Rhizoma extract inhibiting CCL5 in the treatment of acute pharyngitis | ||
Immunology NME4 suppresses NFκB2-CCL5 axis, restricting CD8+ T cell tumour infiltration in oesophageal squamous cell carcinoma | ||
iScience Cancer-associated fibroblasts promote enzalutamide resistance and PD-L1 expression in prostate cancer through CCL5-CCR5 paracrine axis | ||
Stem Cells Targeted deletion of Rictor in BMSCs reduces the biological activity of K7M2 cells and mitigates OS-induced bone destruction | ||
Ann Transl Med Upregulation of STAT1-CCL5 axis is a biomarker of colon cancer and promotes the proliferation of colon cancer cells. |

