Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IP | See 1 publications below |
Product Information
12310-1-AP targets HRPT2, CDC73 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2959 Product name: Recombinant human HRPT2; CDC73 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 109-409 aa of BC014351 Sequence: WRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKGKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF Predict reactive species |
| Full Name | cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) |
| Calculated Molecular Weight | 531 aa, 61 kDa |
| Observed Molecular Weight | 61 kDa |
| GenBank Accession Number | BC014351 |
| Gene Symbol | HRPT2/CDC73 |
| Gene ID (NCBI) | 79577 |
| RRID | AB_2078388 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6P1J9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Parafibromin is a product of the hyperparathyroidism-jaw tumor syndrome gene HRPT2/CDC73, a putative tumor suppressor gene recently implicated in the autosomal dominant hyperparathyroidism-jaw tumor familial cancer syndrome, sporadic parathyroid cancer, and a minority of families with isolated hyperparathyroidism (PMID: 15580289). Defects in CDC73 are causes of hyperparathyroidism type 1 (HRPT1) and hyperparathyroidism type 2 (HRPT2) as well as parathyroid carcinoma (PRTC) (PMID: 12434154). Tumor suppressor parafibromin to the transcription elongation and RNA processing pathway as a PAF1 complex- and RNA polymerase II-bound protein (PMID: 15923622). Besides, parafibromin is also involved in post-transcriptional control pathways (PMID: 16116486). Recent report has revealed that pathogenic mutation, such as CDC73 gene mutation, is able to affect histone monoubiquitination (PMID: 22021426).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HRPT2, CDC73 antibody 12310-1-AP | Download protocol |
| IHC protocol for HRPT2, CDC73 antibody 12310-1-AP | Download protocol |
| IP protocol for HRPT2, CDC73 antibody 12310-1-AP | Download protocol |
| WB protocol for HRPT2, CDC73 antibody 12310-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











