Tested Applications
| Positive IP detected in | mouse pituitary gland tissue |
| Positive IHC detected in | human pituitary tissue, mouse ovary tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
18041-1-AP targets Oxytocin-neurophysin 1 in IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12672 Product name: Recombinant human OXT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-125 aa of BC101841 Sequence: ACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR Predict reactive species |
| Full Name | oxytocin, prepropeptide |
| Calculated Molecular Weight | 125 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC101841 |
| Gene Symbol | OXT |
| Gene ID (NCBI) | 5020 |
| RRID | AB_2918056 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01178 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Oxytocin (OXT) is a neuropeptide involved in social-approach behaviors in humans and others mammals (PMID: 27325757). OXT is located on chromosome 20p13 and codes for a precursor protein that is synthetized to produce oxytocin and neurophysin I, and neurophysin I is the carrier protein for oxytocin (PMID: 1486803, PMID: 18566739). Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR) (PMID: 18174156).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Oxytocin-neurophysin 1 antibody 18041-1-AP | Download protocol |
| IP protocol for Oxytocin-neurophysin 1 antibody 18041-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











