Tested Applications
| Positive WB detected in | HUVEC cells |
| Positive IHC detected in | human appendicitis tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 39 publications below |
| IHC | See 4 publications below |
| IF | See 9 publications below |
Product Information
20894-1-AP targets E-selectin/CD62E in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14944 Product name: Recombinant human SELE protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 22-371 aa of BC142711 Sequence: WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALS Predict reactive species |
| Full Name | selectin E |
| Calculated Molecular Weight | 610 aa, 67 kDa |
| Observed Molecular Weight | 115 kDa |
| GenBank Accession Number | BC142711 |
| Gene Symbol | CD62E |
| Gene ID (NCBI) | 6401 |
| RRID | AB_10755287 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16581 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
E-selectin, also known as ELAM-1 or CD62E, is a member of the selectin family of adhesion molecules that also includes L-selectin and P-selectin. E-selectin is an inducible endothelial cell surface molecule. Its expression on endothelial cells is transcriptionally upregulated by various proinflammatory substances such as IL-1, TNFα and lipopolysaccharide (LPS). Besides, it can be secreted by endothelial cells, and can be detected in a soluble form (sE-selectin) in serum. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. (PMID: 2827173; 1382417; 8943958)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for E-selectin/CD62E antibody 20894-1-AP | Download protocol |
| WB protocol for E-selectin/CD62E antibody 20894-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Astrocyte-Derived Extracellular Vesicular miR-143-3p Dampens Autophagic Degradation of Endothelial Adhesion Molecules and Promotes Neutrophil Transendothelial Migration after Acute Brain Injury | ||
Sci Adv The support of genetic evidence for cardiovascular risk induced by antineoplastic drugs. | ||
Adv Healthc Mater Boosting Tumor Accumulation of Phthalocyanine through Sialylation Engineering for Superior Cancer Phototherapy | ||
ACS Appl Mater Interfaces Inflammation-Driven Nanohitchhiker Enhances Postoperative Immunotherapy by Alleviating Prostaglandin E2-Mediated Immunosuppression | ||
Biomater Sci An E-selectin targeting and MMP-2-responsive dextran-curcumin polymeric prodrug for targeted therapy of acute kidney injury | ||
Genomics MIN score predicts primary response to infliximab/adalimumab and vedolizumab therapy in patients with inflammatory bowel diseases. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Yannic (Verified Customer) (01-07-2022) | Left and right band refer to markers. Many unspecific bands, blocked with 5% BSA, primary antibody over night
![]() |










